KEGG   Acidovorax avenae: Acav_3234Help
Entry
Acav_3234         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4123
Motif
Other DBs
NCBI-ProteinID: ADX47136
UniProt: F0Q8D8
Position
complement(3681519..3682376)
Genome map
AA seq 285 aa AA seqDB search
MSRRFIPQEIRPADQEQQRLTERHLQGRLAEVEHYLYAVRREIDQELPGCIPTYRKPYPY
GCCLEISEAFEKKLRAAVASDAALPGLDAIRAFMGEGGYVGSVWGALRERYFQNAFQFGS
LYVDVSNDTVDVRKPSIEILPMAESGLVNISSLEHFVRIGQAYWGAEFYANDVWPALAPI
APLVMHLPDRHALQLSNRSAYMVAWQRRDRYQGAEAYLSSAPSLPAAARESFLACIAPRR
RVADARQGRALSMAACASLRKATPLQESMWLNRQLTEWGASEGQA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgtcgtttcatcccccaggaaatccgccctgcagaccaggagcagcaacgcctg
accgagcgccacctgcagggccggctggccgaggtggagcactacctgtatgccgtgcgc
cgtgaaatcgaccaggaactgccaggttgcatccccacgtaccgcaagccctatccctac
ggctgctgcctggagatttcggaggcgttcgagaagaagctgcgtgcggcggtggcatcg
gacgctgcgctgcccgggctggacgccatccgcgccttcatgggcgagggtggttacgtg
ggctccgtctggggcgctctgcgcgagcgctacttccagaatgcgttccagttcggcagc
ctgtacgtggatgtctccaacgacacggtggacgtgcgcaagccctcgatcgaaatcctg
ccgatggcggagtctgggctggtgaacatttccagcctggagcatttcgtgcggattggc
caggcctactggggggcggagttctacgccaacgacgtgtggccggcgcttgcgccgatc
gctccgctcgtgatgcacctgccggacaggcacgccttgcaactctcgaaccgctcggcc
tacatggtggcctggcagcggcgggaccgctaccagggggcggaagcctacctgtccagc
gcgccgtccctgccggcggcggcgcgggagtccttcctggcatgcatcgcgccgcgccgc
agggtggcggacgcacggcagggccgggccttgtccatggcggcctgcgcctccctgcgc
aaggccacgcccctgcaggagtccatgtggctcaaccggcagctgacggagtggggcgcc
tccgaagggcaggcctga

DBGET integrated database retrieval system