KEGG   Acidovorax avenae: Acav_3240Help
Entry
Acav_3240         CDS       T01445                                 

Definition
(GenBank) protein of unknown function DUF839
  KO
K07093  uncharacterized protein
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Acav_3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF839
Motif
Other DBs
NCBI-ProteinID: ADX47142
UniProt: F0Q8E4
Position
3688836..3690782
Genome map
AA seq 648 aa AA seqDB search
MSHTPMPSRRKALQFLAGMPLLPLGASASAASMLAACGGGSDGALSSYASTSFSSMAAPT
LAQPAAMATTTVGSTMSVKFTNGSAANYQLAYQPFFMTGDQVPSTAGGTILAGGYFDINN
KPIIDASVPGKERPFFSDCPDGTSLLKLDNASVSGVKGNPVFAVVQFEYTTRNQAQASMY
GLLPSPIAVLTLDQDPATGKLTLVKYHNVDTSGVKGLWITCGASLSPWNTHLSSEEYEPD
ATLATNAQLQGFSKALFGDAAKANPYDYGHMPEVTVNPDGTGSIKKHYCMGRISHELVQV
MPDNRTALMGDDATNGGLFMFVADKEKDLSAGTLYVGKWKQTSGKGPGAGDISWINLGHA
TSAEIKALVDGGIKASDIMDVKTSDPSDSSYTQIFFSGKKNWVKLKPGMEKAAAFLETHR
YAALKGASMGFTKMEGTTVNIKDKKAYSAMSYVQTSMLKGNAANQGDIQVEGPKAGAVYE
HTLTGGQKDTSGNAINSEWVSVHMEAPAALIGEDLAKADALGNLANADKIANPDNIKFAE
KLRTLFIGEDSGMHVNNFLWAYNVDTKQLSRVLSVPAGAESTGLQAVDEINGWTYVMSNF
QHPGDWETPLHDNVKATLDPLVRANYKDRFGASVGYLTATSTQMSLKG
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaccccgatgccctcccgccgcaaagccctgcaattcctggccggcatgccc
ctgctgcccctgggcgccagcgcatccgcagcttccatgctggccgcctgcggtggcggc
agcgatggagcgctctcctcctacgcctcgaccagcttcagctccatggccgcgcccacc
ctggcgcaaccggccgccatggccaccaccaccgtgggctccacgatgagcgtgaagttc
accaatggcagcgcggccaactaccagctggcctaccagcccttcttcatgacgggcgac
caggtgcccagcacggccggcggcaccatcctggccggcggctacttcgacatcaacaac
aagccgatcatcgacgcgtcggtgcccggcaaggagcgccccttcttctccgactgcccc
gatggcacctcgctgctgaagctggacaacgccagcgtgtcgggtgtcaagggcaacccg
gtgttcgccgtggtgcagttcgagtacaccacccgcaaccaggcccaggcatcgatgtac
ggcctgctgccctcgcccatcgccgtgctgacgctggaccaggacccggccaccggcaag
ctgaccctggtcaagtaccacaacgtggacacgtccggcgtgaagggcctgtggatcacc
tgcggcgccagcctctctccctggaacacccacctgtccagcgaagagtacgagcccgac
gccacgctggccaccaacgcccagctgcagggcttcagcaaggcgctgttcggcgacgcc
gccaaggccaatccctacgactacggccacatgcccgaagtgaccgtcaaccccgacggc
accggcagcatcaagaagcactattgcatgggccgcatctcgcatgaactcgtgcaggtc
atgcccgacaaccgcaccgccctgatgggcgacgatgccaccaacggcggcctgttcatg
ttcgtggcggacaaggaaaaggatctctccgccggcacgctgtacgtgggcaagtggaag
cagacctccggcaagggccccggtgccggcgacatcagctggatcaacctcggccatgcg
accagcgccgagatcaaggccctggtcgatggcggcatcaaggcctccgacatcatggac
gtgaagaccagcgacccgtccgacagcagctacacgcagatcttcttcagcggcaagaag
aactgggtcaagctcaagcccggcatggaaaaggctgccgccttcctggaaacccatcgc
tacgccgcgctcaagggcgcgtcgatgggcttcaccaagatggaaggcacgacggtcaac
atcaaggacaagaaggcctattccgccatgtcctacgtgcagaccagcatgctcaagggc
aacgccgccaaccagggcgacatccaggtcgagggccccaaggcgggcgccgtgtacgag
cacaccctcacgggcggccagaaggacacgtcgggcaacgccatcaacagcgaatgggtg
tccgtgcacatggaagcaccggccgcgctcatcggagaagatctggccaaggccgacgcg
ctgggcaacctggccaacgccgacaagatcgccaatcccgacaacatcaagttcgcggaa
aagctgcgcaccctgttcatcggcgaagacagcggcatgcacgtgaacaacttcctgtgg
gcctacaacgtcgacacgaagcagctcagccgcgtgctgtcggtgcccgcgggcgccgaa
tccaccggcctgcaggccgtggacgagatcaacggctggacttacgtcatgagcaacttc
cagcatcccggcgactgggaaaccccgctgcacgacaacgtcaaggccacgctggatccg
ctggtgcgcgccaactacaaggaccgcttcggcgcctcggtcggatacctgaccgccacc
agcacgcagatgagcctgaagggctga

DBGET integrated database retrieval system