KEGG   Acidovorax avenae: Acav_3245Help
Entry
Acav_3245         CDS       T01445                                 

Definition
(GenBank) Collagen triple helix repeat-containing protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-ProteinID: ADX47147
UniProt: F0Q917
Position
3696278..3697096
Genome map
AA seq 272 aa AA seqDB search
MPFSPPHRIRFAALCWAGAMHCHAVLAADILLAPPPNGGFSVTSSDKTQIRLRVDEASGT
VTMPGLASVPQQGTPVCHGPGGVLGDCSAGVVGATGATGATGATGPAGATGPTGSAGPTG
ATGAAGPTGASGATGTIGPTGAAGPAGPAGPTGPTGATGATGTQGGIGPAGPTGATGSVS
AAVAIRTFTLPNVGSDTCTVVSCCNPGEKVLGGGHAANTGRASPEDAAVYVGESRPVDSC
GGTAGTLGWSVKILNSYRANLQSCSAYAICSQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcctttttctccaccccatcgcatccgtttcgccgcgctctgctgggcgggcgccatg
cactgccatgccgtgctggcggcggacatcctgctggcccctccgcccaacggcggcttc
tcggtgaccagcagcgacaagacgcagatccggctgcgcgtggacgaggcctcgggcact
gtcacgatgcccgggctggcctcggtgccgcagcagggcacgcccgtgtgccatggtccg
ggcggcgtgctcggcgattgcagcgccggggtcgtcggggccaccggggcgaccggagcc
acgggtgcgaccggcccggcaggggcgaccggccccacgggcagcgcgggccccacggga
gcgacaggcgctgcggggcccacgggggcatccggtgccactggaaccatcggccccacg
ggtgcggccggccctgccgggcccgcaggtccgaccggccctaccggtgcgacgggagcg
acaggcacccagggcggcatcggtccggccgggcccacgggcgcgacgggctccgtgagc
gcggccgtcgcgatccggactttcacgctgcccaacgtgggcagcgacacctgtacagtc
gtgtcctgctgcaatcccggagagaaagtgctgggtggcggacacgccgcgaataccggc
agggcctcgcccgaagatgcagccgtctacgtcggcgagagccgcccggtcgatagctgc
ggaggcaccgcaggtactctcggctggtcggtgaagatactcaattcgtaccgcgcgaac
ctgcagagctgctccgcctacgccatttgctcgcagtag

DBGET integrated database retrieval system