KEGG   Acidovorax avenae: Acav_3246Help
Entry
Acav_3246         CDS       T01445                                 

Definition
(GenBank) Aspartyl/Asparaginyl beta-hydroxylase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Arg_Hydrox Cupin_2 Nif11
Motif
Other DBs
NCBI-ProteinID: ADX47148
UniProt: F0Q918
Position
3697120..3697974
Genome map
AA seq 284 aa AA seqDB search
MTETTHTPQARHDAATPEFPHARRIACGIDMAAALAEIDALPDAQWCPHFNLAKHNGGWH
VAALRGTPRSPLAAAPGEFSADLYQDGAAMAQCPSVRALVAAIAGDAPLKSVRVLRLAPG
GTILEHTDPGVGLRDGEARLHLPLRTHDEVFFYVGGERVPMRAGEWWYADFSLPHRVANR
GTRERLHLVVDCAATPALHKAIAAGDAGSPLSEAHDPQWQFARFRQEVFGDPALQERLIG
IRSREDFAQACVQQGQALGRYFSEAEVLSAMACGRDAWTRQWIV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccacgcacacgccccaggcccggcacgacgccgccacgccagagttcccg
catgcacggcgcattgcctgcggcatcgacatggccgccgcactggcggagatcgatgca
ttgcctgacgcccagtggtgcccgcatttcaacctcgccaaacacaacggcggctggcat
gtggccgcactgcgcggcacgccccgctcgcccctggccgccgcgccgggggagttctcc
gccgacctctaccaggacggcgccgcgatggcgcagtgcccgtccgtgcgcgcgctggtg
gccgccatcgcgggcgacgcgcccctgaaatcggtacgggtgctgcggctggcgcccgga
ggcaccatcctcgaacacaccgatccaggggtcggcctgcgggatggcgaagcccgcctg
cacctgccgttgcgcacgcacgacgaggtgttcttctacgtgggcggcgagcgcgttccc
atgcgcgcgggggagtggtggtacgccgatttttccctgccccaccgcgtggccaaccgg
ggaacccgcgagcgcctgcacctcgtggtcgattgcgcggccacgccagcgctgcacaag
gccatcgccgcgggagatgcgggctcgccgctgtccgaagcgcacgacccgcaatggcag
ttcgcacggttccgccaggaggtcttcggcgatccggcgctgcaggaacgcctgatcggc
atccgctcgcgcgaggatttcgcacaggcctgcgtgcagcagggccaggccctgggccgg
tatttttccgaggcggaggtcctgtccgccatggcctgcgggcgcgatgcatggacgcgg
caatggatcgtctga

DBGET integrated database retrieval system