KEGG   Acidovorax avenae: Acav_3254Help
Entry
Acav_3254         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX47156
UniProt: F0Q926
Position
3706479..3707231
Genome map
AA seq 250 aa AA seqDB search
MRTTLPALLLCLAPAWMATAPSSAAAQWTACSSDGKAAPSALYERFLGADCATCWADAPA
REPGGQALVLDWIVPGRQGDDAPLSAAATRDALERLQALRRDPPAATDTAITDVAPTAPL
PGRLRVALGPPVNGYVGATIALARPGGKAAAPHVRAGTRYAFTLLLVETVAAGAEGNAAE
RHIVRNALQGTWEAGTAAPRGGWSELRPMRIPDGADPERLGAVGWLQDAGGTVVAAARAH
CPARDAGRPQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccaccctccctgccctgctcctctgcctcgccccggcctggatggccacggcc
ccctcatccgcagcggcccagtggaccgcgtgcagcagcgatggcaaggccgcgccgagc
gcgctctacgagcgcttcctcggtgccgactgcgccacctgctgggccgatgcgccggcc
agggaacccggcggccaggccctcgtgctggactggatcgtgccaggccgccagggtgac
gacgcccccctgtctgccgccgcaacgcgcgatgcgctggagcgcctgcaggcgctgcgc
cgcgacccgcccgcggccaccgacaccgccatcaccgacgtcgcccccaccgccccgctg
ccgggccggcttcgcgtggccctgggcccacccgtcaacggctatgtcggcgccaccatc
gccctggcgcgccccgggggcaaggccgcagccccgcatgtccgcgccggcacccgctat
gccttcacgctgctgctggtcgaaaccgtggccgccggagcggagggcaacgccgccgaa
cggcacatcgtgcgcaatgcactgcagggcacctgggaggccggcacggcagcgccgcgt
ggcggatggtcggagctgcggcccatgcgcatccccgacggtgccgacccggagcggctc
ggcgccgtgggctggctgcaggatgcaggcggcacggtggtcgcggcggcacgcgcccac
tgccccgcccgcgatgccggcagaccgcagtaa

DBGET integrated database retrieval system