KEGG   Acidovorax avenae: Acav_3255Help
Entry
Acav_3255         CDS       T01445                                 

Definition
(GenBank) guanosine monophosphate reductase
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
aaa  Acidovorax avenae
Pathway
aaa00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acav_3255
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     Acav_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH FMN_dh NMO His_biosynth TMP-TENI DHO_dh ThiG B12-binding
Motif
Other DBs
NCBI-ProteinID: ADX47157
UniProt: F0Q927
Position
3707459..3708436
Genome map
AA seq 325 aa AA seqDB search
MEIFDYDNVLLLPRKCRVESRSECDASITLGQRSFRLPVVPANMKTVVDEKICRWLASNG
YFYVMHRFDLDNVQFVRDMHGAGCFASISLGVKQPDYDTVDRLVAEGLCPEYITIDIAHG
HADTVKAMIAYLKQHLPQAFIIAGNVATPEAIIDLENWGADATKVGVGPGKVCITKLKTG
FGTGGWQLSALKWCARVATKPIIADGGIRSHGDIAKSIRFGATMVMIGSLFAGHEESPGK
TVEVDGEQFKEYYGSASDFNKGEYKHVEGKRILEPIKGKLADTLVEMEQDVQSSISYSGG
TKLMDVRKVNYVILGGDNAGEHLLM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttcgactacgacaacgtcctgctgctgccgcgcaaatgccgcgtggagagc
cgatccgagtgcgacgccagcatcaccctcgggcagcgcagcttccgcctgccggtggtg
ccggcgaacatgaagacggtggtggacgagaagatctgccgctggctcgccagcaacggc
tacttctacgtcatgcaccgcttcgacctcgacaacgtgcagttcgtgcgcgacatgcat
ggtgccggctgcttcgcctccatctcgctgggcgtgaagcagcccgactacgacacggtg
gaccggctcgtggcggaaggcctctgccccgaatacatcaccatcgacatcgcccacggc
catgccgacacggtgaaggccatgatcgcctacctcaagcagcacctgccgcaggccttc
atcatcgccggcaacgtggccacgccggaggccatcatcgacctggagaactggggcgcg
gacgcgaccaaggtgggcgtgggtccgggcaaggtgtgcatcaccaagctcaagaccggc
ttcggcaccggcggctggcagctctccgcgctcaagtggtgcgcccgcgtggccaccaag
cccatcatcgccgacggcggcatccgcagccacggtgacatcgccaagagcatccgcttc
ggcgccaccatggtcatgatcggctcgctcttcgccggccacgaggaatcgcccggcaag
accgtggaagtggatggcgagcagttcaaggaatactacggctccgccagcgacttcaac
aagggcgagtacaagcacgtggaaggcaagcgcatcctcgagcccatcaagggcaagctg
gcggacacgctggtggagatggaacaggacgtgcagagttcgatcagctactccggcggc
acgaagctgatggacgtgcgcaaggtcaactacgtgatcctgggcggcgacaacgccggc
gaacacctgctgatgtga

DBGET integrated database retrieval system