KEGG   Acidovorax avenae: Acav_3261Help
Entry
Acav_3261         CDS       T01445                                 

Definition
(GenBank) RNA polymerase, sigma 54 subunit, RpoN
  KO
K03092  RNA polymerase sigma-54 factor
Organism
aaa  Acidovorax avenae
Pathway
aaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acav_3261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aaa03021]
    Acav_3261
Transcription machinery [BR:aaa03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Acav_3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID MarR_2 LacI HTH_23 Fe_dep_repress HTH_IclR HTH_38 HTH_3 GntR HTH_Tnp_ISL3 HTH_17 HTH_AraC MarR HTH_Crp_2 Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: ADX47163
UniProt: F0Q933
Position
3715548..3716954
Genome map
AA seq 468 aa AA seqDB search
MPTLALGARQTQSPHLSPRLQKAVQLLQMPTAEFIQSVMAAVDENPFLEEDEPAAPAAPG
PEDGPAWTAAPGSRSHQGGSGDGLSMLEREPATATLHEHLHAQLRLLRLPDRAFLLASLV
VEELSEDGYLATPLESLCGDYGVEPQATAEELDAALRAVQSLEPAGVGARDLQECLRLQL
PAVACPLQRALCDAVLARAAEGSGPQAMRQLAARLDVPAHAVREAMERLRHLDPHPGWRH
GSQPVQYIVPDVIAHKARGQWTVSLNEAVMPRVRVHRQYQQLLQSPADAPDGPTPASEDT
GSRSAHRDLAAQLAEARWTVRHVQQRFSTVLDVARAILRRQPHFLEYGPIGMRPLALKDI
AEELGVHVSTVSRVTNNKYLQTPFGLFELKYFFSRAMTTPAGRDSSPTAIRGLVQEILAA
DDGLRPLSDVDIARQLERQGIRIARRTVTKYRQQLRIPPAEQRAAARP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacttgctcttggagcccgacagacccagtccccgcacctttcgccccgcctg
cagaaggccgtgcaattgctgcagatgccgacggcggagttcatccagagcgtgatggcc
gccgtggacgagaacccgttcctggaggaagacgaaccggcggcgcctgctgccccgggc
ccggaagacgggcctgcctggaccgctgcaccgggctcccggtcgcaccagggcggcagc
ggcgatggcctgtccatgctggaacgcgaaccggccaccgccacgctgcacgaacacctg
cacgcgcaactgcgcctcttgcggctgcccgaccgtgcattcctcctggcaagcctggtc
gtcgaggagttgtccgaagacggctacctcgccacccctctggagtccctctgcggcgac
tacggcgtggagccgcaggccacggccgaggaactggacgctgcgctgcgcgccgtgcag
tccctggaacccgcaggcgtgggcgcgcgcgatctgcaggaatgcctgcgcctgcagttg
cccgcggtcgcctgcccgctgcagcgtgcgctgtgcgatgcggtattggccagggcggcg
gaaggctccgggccgcaggccatgcggcagctggcggcacggctggatgtacccgcgcat
gccgtacgggaggcgatggagcggctgcgacacctcgacccgcacccgggatggcggcac
ggatcccagccggtgcagtacatcgtgcccgatgtcatcgcgcacaaggcccgtggccag
tggaccgtctcgctgaacgaggccgtcatgccgcgcgtgcgcgtccaccgccagtaccag
caattgctgcagtcgccggccgatgcgccggacgggcccacgcccgcctctgaagacaca
ggatcgcgcagcgcgcaccgcgatctggccgcacagctggccgaggcgcgctggacagtc
cgccatgtgcagcagcgcttttccaccgtgctcgacgtcgccagggccatcctgcgccgg
cagccccacttcctggaatacggccccatcggcatgcggccgctggcgctcaaggacatc
gcggaagaactgggcgtgcatgtctccaccgtatcgcgggtgacgaacaacaagtacctg
cagacgccgttcggcctgttcgagctgaagtacttcttctcccgcgccatgaccacgcca
gcaggccgggacagttcgcccaccgccatccgcgggctcgtgcaggaaatcctcgcggcg
gacgatggcctgcggccgctttccgacgtggacatcgcacggcaactcgagcgccagggc
atccgcatcgcgcgccgcaccgtgaccaagtaccggcagcaactgcgcataccgcccgcg
gagcagcgtgctgccgcacgcccctga

DBGET integrated database retrieval system