KEGG   Acidovorax avenae: Acav_3265Help
Entry
Acav_3265         CDS       T01445                                 

Definition
(GenBank) diguanylate cyclase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF PAS_8 PAS_9 PAS_4 PAS VP4_helical
Motif
Other DBs
NCBI-ProteinID: ADX47167
UniProt: F0Q937
Position
complement(3719372..3720856)
Genome map
AA seq 494 aa AA seqDB search
MHGVLRKMTFPPSSDNDFEHMFDLAPVSLWLEDFSALKSLLDGWRSEGVVDAEAYVREDP
ARMQQYGASLKVLRVNRRTLELFAAPDQATLLASLDQVFRGDMFEQAISELRQLWSGSLE
FSNQTVNYALDGRRLDVHIRGRILPGHEDRWDRVLISLEDNTDQIRSSTALLRSEQYARG
LFEHSPVSLWVEDFSCVKRLLDDVRAQGIRDFKTFLKVHPEFVTRCMQEIRVIDVNQQTL
EMFGADSKDQLLQQIGKVFRGEMAESFAEQLLDLWDGKLVQQREVVNYSLSGEPVYIHMQ
FAVLDERRHDWSMVLLSLVDITARKKAEAYLEYLGKHDVLTQLRNRAFYMEELNRLVRKG
PWPVAVVVVDLNGLKAINDEYGHAAGDAMLRRVGEVLSKAVDSPDCAARIGGDEFALLLP
ACDERGAQVVTDRIASLLELNNQFYPGKPLSLAIGTAIAATGDQVEAAVHRADQAMYAEK
LRYYQQAGLERRRG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcacggagtgctccgaaaaatgaccttccctccctcgtcggacaacgattttgaacac
atgttcgacctggccccggtgtcgctgtggctggaggacttcagcgcgctgaagtcgctg
ctcgacggctggcgcagcgagggagtcgtggatgccgaggcctatgtgcgcgaggacccc
gcgcggatgcagcagtacggcgcgagcctgaaggtgctccgggtgaaccggcgcacgctg
gagctgtttgccgcgcccgaccaggccacgctgctggcctcgctggaccaggtgttccgc
ggcgacatgttcgagcaggcgatctccgagctgcggcagctgtggtccggttcgctggaa
ttctccaaccagacggtcaactatgcgctcgacggccgccgcctcgatgtgcatatccgc
ggccgcatcctgcccggacacgaggaccgctgggaccgcgtgctgatttcgctcgaggac
aacaccgaccagatccgctccagcacggcactcctgcgcagcgagcagtatgcgcggggc
ctgttcgagcattcaccggtatcgctgtgggtggaggacttcagctgcgtcaagcgcctg
ctggacgacgtgcgcgcgcagggcatccgtgatttcaagacgttcctgaaggtgcatccg
gagttcgtcacgcgctgcatgcaggagatccgcgtcatcgacgtgaaccagcagacgctg
gagatgttcggcgccgacagcaaggaccagttgctccagcagatcggcaaggtgttccgc
ggagagatggccgagtcgttcgccgagcagttgctcgacctgtgggacggcaagctggtg
cagcagcgcgaggtcgtgaactacagcctctcgggcgagccggtgtacatccacatgcag
ttcgccgtgctggacgaacgcaggcacgactggtccatggtgctgctgtcgctggtggac
atcacggcgcgcaagaaggcggaggcctatctggagtacctcggcaagcacgatgtactc
acacagttgcgcaaccgcgccttctacatggaggaactgaaccggctcgtccgcaaaggt
ccctggccggtggccgtggtggtcgtggacctgaacgggctcaaggccatcaacgacgag
tacggtcatgcggcgggcgatgcgatgttgcgccgtgtgggcgaggtgctcagcaaggcg
gtggactccccggattgcgctgcgcgcatcggcggcgacgaattcgccctgttgctgccg
gcctgcgacgagcgcggcgcacaggtcgtcaccgatcggatcgcatcgctgctggagctc
aacaaccagttctatcccggcaagccgctgagcctggcgatcgggacggccatcgcggcc
acgggcgaccaggtcgaggcggccgtgcaccgtgccgaccaggccatgtacgcggagaaa
ctgcgctactaccagcaggcggggctggagcgccgccgcggctga

DBGET integrated database retrieval system