KEGG   Acidovorax avenae: Acav_3447Help
Entry
Acav_3447         CDS       T01445                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aaa  Acidovorax avenae
Pathway
aaa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Acav_3447
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Acav_3447
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Acav_3447
    1.1.1.-  
     Acav_3447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADX47348
UniProt: F0QAW0
Position
complement(3912590..3913657)
Genome map
AA seq 355 aa AA seqDB search
MKAARFHGRGDIRIEDIPEPVVEPGTVGIEVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVTDIQVGQHVVVEPYIVADDVPTGPGDHYHLSKNMNF
IGLGGRGGGLSERIAVKRRWVHPISDAIPLDQAALIEPLSVGHHAFTRSGAKAGDVALVG
GAGPIGLLLSAILKAKGLTVIVTELSGKRKQKARESGVADHILDPSEVDVVAEVMRLTGD
QGVDVAFECSSVNKVLDTLVAVTRPTGVVVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHQETIKLVEQGKINLEPFITQRIQLEDLVAKGFDTLIHNNESAVKIIVQPRLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttccacggccgtggcgatatccgcatcgaagacattcccgaaccc
gtggtggagcccggcaccgtgggcatcgaagtggcctggtgcggcatctgcggcaccgac
ctgcacgagttcatggaagggccgatcttcatcccgccctgcggccatccgcaccccatc
tcgggcgaatccgcccccgtcaccatgggccatgaattctccggcgtggtctatgccgtg
ggcgaaggggtgacagacatccaggtcggccagcacgtcgtggtggagccctacatcgtg
gccgacgacgtgcccacgggcccgggcgaccactaccacctgtcgaagaacatgaacttt
atcggcctgggcgggcgcggtggcggcctgtccgaaaggatcgccgtcaagcgccgctgg
gtgcatcccatctccgacgccattccgctggaccaggccgcgctgatcgagccgctctcg
gtgggccaccatgccttcacccgcagcggcgccaaggccggcgacgtggcgctggtgggc
ggggccggccccatcggcctgctgctgtcggccatcctgaaggccaagggcctcacggtg
atcgtcaccgagctgagtggcaagcgaaagcagaaggcgcgcgaatccggcgtggccgac
cacatcctcgacccctccgaggtggacgtggtggccgaggtgatgcggctcaccggcgac
cagggcgtggacgtggcgttcgaatgctccagcgtcaacaaggtgctcgacaccctcgtg
gccgtaaccaggcccacgggcgtggtggtgatcgtctccatctggagccacccggccacc
atcaacgtgcacagcgtggtgatgaaggaactggacgtgcgcggcaccattgcctactgc
aacgaccaccaggaaaccatcaagctcgtcgagcagggcaagatcaacctggagcccttc
atcacccagcgcatccagctggaggacctggtggccaaggggttcgacacgctgatccac
aacaatgaatcggcggtgaagatcatcgtgcagccgcggctgaagtag

DBGET integrated database retrieval system