KEGG   Acidovorax avenae: Acav_4063Help
Entry
Acav_4063         CDS       T01445                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
aaa  Acidovorax avenae
Pathway
aaa00360  Phenylalanine metabolism
aaa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aaa00790  Folate biosynthesis
aaa01100  Metabolic pathways
aaa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Acav_4063
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acav_4063
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acav_4063
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Acav_4063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ADX47953
UniProt: F0Q4C3
Position
4645631..4646470
Genome map
AA seq 279 aa AA seqDB search
MGQAPVVYGQSDRPPRGDYARAGSDYTCAQDYAAYTPQDHDTYRRLYARQSALLPGRASE
AFIAALPSLGASDRIPRFDEINERLQRATGWEIVGVPGLIPEVPFFTLLANRKFPVTDWI
RTPEEFDYIVEPDIFHDLFGHVPLLFNPVFADYVQRYGQGGLKAHGLGACEMLSRLYWYT
IEFGLIRERGALRAYGAGILSSSGELEYSVNSPGPQRLPLQLERTMRTRYKIDTYQQTYF
VIDSFEQLFAMTEPDFGPVYERLRGQPEFAADEREAVAA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggacaagcccccgtcgtttacggccaatccgaccgccccccgcgcggcgactacgcc
cgcgccggcagcgactacacctgcgcgcaggactatgcggcctatacaccgcaggaccac
gacacctaccggcggctgtacgcccgccagtctgccctgctgcccggccgcgcgagcgag
gccttcatcgccgccctgccatcgctgggcgcgagcgaccgcatcccgcgcttcgacgag
atcaacgagcggctgcagcgcgccacgggctgggagatcgtgggcgttccgggcctgatt
cccgaagtgcccttcttcacgctgctggcgaaccgcaagttcccggtgacggactggatc
cgcacgcccgaggagttcgactacatcgtggagccggacatcttccatgacctgttcggg
cacgtgccgctgctgttcaacccggtgttcgcggactacgtgcagcgctacggccaggga
ggcctgaaggcgcacgggctgggtgcctgcgagatgctgtcgcgcctgtactggtacacg
atcgagttcggcctcatccgcgagcgcggcgcgctgcgcgcctacggggcgggcatcctc
agttcttccggcgagctggaatattcggtgaacagccccgggccgcaacgcctgccgctg
cagctggagcgcacgatgcgcacgcgctacaagatcgacacataccagcaaacgtatttc
gtgatcgacagcttcgagcagctgttcgcgatgacggagccggatttcgggccggtgtac
gagcgcctgcgcggacagcccgagttcgccgcggacgagcgcgaggccgtggcggcctga

DBGET integrated database retrieval system