KEGG   Acidovorax avenae: Acav_4265Help
Entry
Acav_4265         CDS       T01445                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aaa  Acidovorax avenae
Pathway
aaa00071  Fatty acid degradation
aaa00072  Synthesis and degradation of ketone bodies
aaa00280  Valine, leucine and isoleucine degradation
aaa00310  Lysine degradation
aaa00362  Benzoate degradation
aaa00380  Tryptophan metabolism
aaa00620  Pyruvate metabolism
aaa00630  Glyoxylate and dicarboxylate metabolism
aaa00640  Propanoate metabolism
aaa00650  Butanoate metabolism
aaa00900  Terpenoid backbone biosynthesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
aaa01212  Fatty acid metabolism
aaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acav_4265
   00630 Glyoxylate and dicarboxylate metabolism
    Acav_4265
   00640 Propanoate metabolism
    Acav_4265
   00650 Butanoate metabolism
    Acav_4265
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Acav_4265
   00072 Synthesis and degradation of ketone bodies
    Acav_4265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acav_4265
   00310 Lysine degradation
    Acav_4265
   00380 Tryptophan metabolism
    Acav_4265
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acav_4265
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acav_4265
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acav_4265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaa04147]
    Acav_4265
Enzymes [BR:aaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acav_4265
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acav_4265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ADX48149
UniProt: F0Q6U1
Position
complement(4874285..4875469)
Genome map
AA seq 394 aa AA seqDB search
MQQDPIVIIGAARTPMGAFQGDFSGLAAHDLGGVAIRAAVERAGIAPESVGEVLFGNCLM
AGQGQAPARQAGFKGGLPKSAGAVTLSKMCGSGMKAAMFAHDMLLAGAHEVIVAGGMESM
TNAPYLLQKGRGGYRLGHDRIFDHMMLDGLEDAYEPGRSMGTFGEDCAAKYGFTREQQDA
FAVASVQRAKAATESGAFAAEIAPVTVKTRAGETVVSVDEGPGKVRLDKIPALKPAFKKD
GTITAASSSSINDGAAALVMVRESTARRLGAVPIARIAGHAMHAQEPNWFTTAPVGATQK
ALAKAGWSVQDVDLWEVNEAFAVVPMALMKELDVAHDIVNVNGGACALGHPIGASGARII
VTLIHSLKARGKRRGLATLCIGGGEGTAMAIELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagatcccatcgtcatcatcggcgccgcacgcacgcccatgggggctttccag
ggcgatttctcgggcctggccgcccatgacctggggggcgtggcgatccgtgcggccgtg
gagcgcgcgggcatcgcaccggagagcgtcggcgaagtgctgttcggcaattgcctgatg
gcggggcaggggcaggcgcctgcccgccaagccgggttcaagggcgggctgcccaagagc
gccggagccgtcacgctgagcaagatgtgcggctcgggcatgaaggccgcgatgttcgcg
cacgacatgctcctcgcaggagcgcacgaagtgatcgtggccggcgggatggagagcatg
acgaatgcgccctatctgctgcagaagggccgcggcggctatcggttgggccacgaccgc
atcttcgaccacatgatgctcgacgggctggaggatgcctacgagcctgggcgctccatg
ggaacgtttggcgaggactgcgcggcgaagtacggattcacccgcgaacagcaggatgca
tttgccgtggcgagcgtgcagcgcgcgaaggccgcgacggaatccggcgcgtttgcggcc
gagattgcgccggtgacggtgaagacgcgtgccggcgagacggtggtgtcggtggacgag
gggccgggcaaggtgcggctggacaagattccggcgctcaagccggcgttcaagaaggac
gggaccatcactgcggcatcgagctcgagcatcaacgacggcgccgcggcgctggtgatg
gtgcgcgagtccacggcccgccgtctcggcgccgttccgatcgcgcgcattgcgggccat
gccatgcatgcgcaggagcccaattggttcaccaccgcgcccgtgggcgccacgcaaaag
gcgctggccaaggcaggctggagcgtgcaggacgtggacctctgggaggtgaacgaagcc
tttgcggtagtgcccatggcactcatgaaggagctggacgtagcgcacgacatcgtgaac
gtgaacggcggagcctgtgcgctggggcatccgatcggcgcgagcggggcgcgcatcatc
gtgaccctgatccattcgctgaaggcgcgcggcaagcggcgcgggctggcgacgctgtgc
atcggcggtggcgaaggcacggccatggcgatcgaactggtgtga

DBGET integrated database retrieval system