KEGG   Acidovorax avenae: Acav_4456Help
Entry
Acav_4456         CDS       T01445                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
aaa  Acidovorax avenae
Pathway
aaa00270  Cysteine and methionine metabolism
aaa00480  Glutathione metabolism
aaa01100  Metabolic pathways
Module
aaa_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Acav_4456
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Acav_4456
Enzymes [BR:aaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Acav_4456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST Rimk_N
Motif
Other DBs
NCBI-ProteinID: ADX48339
UniProt: F0Q994
Position
complement(5103865..5104815)
Genome map
AA seq 316 aa AA seqDB search
MNILFVADPVEHFKIYKDTTFSMMREAQRRGHVVSVCEPGHIRWEQGRKVTARVRDLHLT
GDAQAWFTVAGEREAELSGFGAVLMRKDPPFDSEYFYATHLLEQAERERARVFNRPRALR
DHPEKLAIMEFPDLIGPTLVTRDAGDIRRFHSEHGDIILKPLDGMGGMGIFRVKADGLNL
GSIIETLNHDGAQTVMVQKFLPEISEGDKRVLIIGGEPVPYCLARIPQGSEVRGNLAAGG
KGVARALTARDVEIGRRLGPVLLERGMLLAGVDVIGDCVTEINVTSPTCFLEIFDQTGCD
VPSLFVDALEKQLNLR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcttttcgttgccgatccggtcgaacacttcaagatctacaaggacaccacg
ttctcgatgatgcgggaagcccagcgccgggggcatgtggtgagcgtttgcgagccgggc
cacatccgctgggagcagggacgcaaggtgacggcgcgcgtacgcgacctccacctcacg
ggtgacgcgcaggcctggttcaccgtggcaggtgagcgcgaggccgagctttccggattc
ggcgccgtgctcatgcgcaaggaccctcctttcgacagcgagtacttctatgccacccat
ctcctcgagcaggcggagcgggagagggcaagggtcttcaacaggccccgtgcgctgcgc
gaccaccccgagaagctggccatcatggagtttcccgacctcatcgggcccacgctcgtg
acgcgggatgcgggcgacattcggcgcttccactcggaacatggggacatcatcctcaag
ccgttggacgggatgggcggcatgggcatcttccgcgtcaaggccgacggactcaatctg
ggcagcatcatcgaaaccctcaaccacgatggcgcgcagaccgtcatggtgcagaagttc
cttcccgagatatccgagggagacaagcgcgtcctcatcatcggaggcgagcctgtacct
tattgccttgcgcgcattccccagggatcggaagtccgtggcaatctcgctgccggtggc
aagggcgtggcgcgcgctctcactgcccgcgatgtcgagatcggccgccggctcggcccc
gtattgctggagcggggcatgctcctggcgggagtggatgtcatcggcgattgcgttacc
gaaatcaacgtgacgagccccacctgtttcctggagatcttcgaccagacaggatgcgac
gtcccgtccctgtttgtcgatgcgctggagaaacagttgaatttgcgctga

DBGET integrated database retrieval system