KEGG   Acidovorax avenae: Acav_4623Help
Entry
Acav_4623         CDS       T01445                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aaa  Acidovorax avenae
Pathway
aaa00020  Citrate cycle (TCA cycle)
aaa00640  Propanoate metabolism
aaa00660  C5-Branched dibasic acid metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
Module
aaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acav_4623
   00640 Propanoate metabolism
    Acav_4623
   00660 C5-Branched dibasic acid metabolism
    Acav_4623
Enzymes [BR:aaa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acav_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADX48503
UniProt: F0QB08
Position
complement(5292870..5294030)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRNFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIDDVKKLAGDILGMQLKTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQK
VALIASSEGGMDIEEVAHSTPDKIVTEMIDPIAGITTEQSKKVAAAIGLTGASVDQAVDI
FAKIYKCYMETDASLVEINPLNCDSKGNLMALDAKFNFDANALFRHPEIVAFRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVEGILVNIFGGIMKCDTIATGVITACKAVNLNVPLVVRMKGTNEELGKKM
LAESGLPIIAADTMAEAATKIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaataccaaggcaaggaaatcttgcgcaattttggtgtgcccgttccc
cgcggcattcccgcgttcacggtgcaggaagctgtggaagccgcccagaagctcggcggc
cccgtgtgggtggtcaaggcccagatccacgccggtggccgtggcaagggcggcggcgtc
aaggtcgccaagagcatcgacgacgtgaagaagctcgccggcgacatcctgggcatgcag
ctcaagacgcaccagaccggtcccgaaggccagaaggtccgccgcctctacatcgaggac
ggcgccgacatcaagaacgaactctacgtctcgctggtcaccgaccgcgccacgcagaag
gtcgccctgatcgcctccagcgaaggcggcatggacatcgaggaagtggcccactccacg
cccgacaagatcgtcaccgagatgatcgaccccatcgccggcatcaccaccgagcagagc
aagaaggtcgcggccgccatcggcctgacgggcgcctccgttgaccaggccgtggacatc
ttcgcgaagatctacaagtgctacatggaaaccgacgcgtcgctggtggaaatcaatccg
ctgaactgcgactccaagggcaacctgatggccctggacgcgaagttcaacttcgacgcc
aacgccctgttccgccatcctgaaatcgtggcattccgcgatctggacgaagaagatccg
gccgaagtggaagcctccaagttcgacctggcctacatcagcctggacggcaacatcggc
tgcctggtgaacggcgcgggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgtgggcggcggcgccacccccgagaaggtcaccgaa
gccttcaagatcatgctgaagaaccccaaggtcgaaggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtcatcaccgcctgcaaggccgtgaac
ctgaacgtgccgctggtcgtgcgcatgaagggcaccaacgaagagctgggcaagaagatg
ctggccgaatccggcctgcccatcatcgccgcagacaccatggccgaagccgcgacgaag
atcgtcgccgccgtcaagtaa

DBGET integrated database retrieval system