KEGG   Amycolatopsis albispora: A4R43_01825
Entry
A4R43_01825       CDS       T05547                                 

Definition
(GenBank) glutamine--scyllo-inositol aminotransferase
  KO
K13329  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase [EC:2.6.1.110]
Organism
aab  Amycolatopsis albispora
Pathway
aab00523  Polyketide sugar unit biosynthesis
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    A4R43_01825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aab01007]
    A4R43_01825
Enzymes [BR:aab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.110  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase
     A4R43_01825
Amino acid related enzymes [BR:aab01007]
 Aminotransferase (transaminase)
  Others
   A4R43_01825
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase SepSecS
Other DBs
NCBI-ProteinID: AXB41417
UniProt: A0A344L043
Position
complement(350989..352146)
AA seq 385 aa
MINMFQPQVGAEELAAVAEVFDSQWLGYGPQTKAFEQEFADHLGVPAETVLFINSATAGL
HLAMELLNIGPGDEVVFPSVSFPANGHCVAAAGATPVFCDVRPRTLNPTVDDVRAVLTPR
TKAVMLLHYGGQPGDIVEIAQLCQERGIPFIEDAACAVGSSIDGRACGTFADIAIWSFDS
RKIITTGDGGMIYVRDPQLARRAHRLAYQGLDDRGAFAAMKNNGTRRWWDQTIHEVGRRL
IGNDLTAAIGRVQLGKLPGFIRRRGEIIAQYDRLLEDVPGVRRPPALPEGHVSTNYFYWL
QFDDVTVRNTVAEDLLELGIYTTYRYPPLHKVPLFATGVELPGTDEAEAITLLLPLHQSL
TDAEVERVATSLISVLDRRRFREAG
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgatcaacatgtttcagccgcaagtcggagccgaggaactggccgccgtcgcggaggtg
ttcgacagccagtggctggggtacgggccgcagaccaaggccttcgagcaggagttcgcc
gaccacctcggcgtgccggcggagacggtgctgttcatcaactccgccacggccggcctg
cacctggcgatggagctgctgaacatcggtcccggtgacgaggtcgtcttcccgtcggtg
agcttcccggccaacggccactgcgtcgccgccgccggcgccaccccggtcttctgcgac
gtccgcccgcgcacgctcaacccgaccgtcgacgacgtgcgggcggtgctgaccccgcgg
acgaaggcggtcatgctgctgcactacggcggccagcccggcgacatcgtggagatcgcg
cagctgtgccaggagcgcggcatcccgttcatcgaggacgccgcctgcgccgtcgggtcg
agcatcgacggccgggcctgcgggaccttcgccgacatcgccatctggagcttcgactcg
cgcaagatcatcaccaccggcgacggcggcatgatctacgtccgtgacccgcagctggcg
cgccgcgcgcaccgcctggcctaccagggtctcgacgaccggggcgcgttcgccgcgatg
aagaacaacggcacgcggcgctggtgggaccagaccattcacgaggtcggcaggcggctg
atcggcaacgacctgaccgccgccatcggccgcgtccagctcggcaagctgcccggcttc
atccggcggcgcggcgagatcatcgcccagtacgaccggctgctcgaggacgttcccggg
gtgcggcgcccgccggcgctgcccgagggccacgtctcgacgaactacttctactggctg
cagttcgacgacgtgaccgtgcgcaacacggtcgccgaggacctgctggaactgggcatc
tacaccacctaccgctatccgccgctgcacaaggtcccgttgttcgccaccggggtggaa
ctgcccggcaccgacgaggccgaggcgatcaccctgctgctgccgctgcaccagtcgctg
accgacgccgaggtcgagcgagtcgccaccagcctgatctcggtcctcgaccgccgcagg
ttccgcgaggccgggtag

DBGET integrated database retrieval system