KEGG   Amycolatopsis albispora: A4R43_02800Help
Entry
A4R43_02800       CDS       T05547                                 

Definition
(GenBank) theronine dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
aab  Amycolatopsis albispora
Pathway
aab00030  Pentose phosphate pathway
aab01100  Metabolic pathways
aab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A4R43_02800
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A4R43_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AXB41581
UniProt: A0A344L0K7
Position
566197..567267
Genome map
AA seq 356 aa AA seqDB search
MRALTVVPGERDSLEVSELPEPEPGPGDLLVDGIAVGVCGTDKDIVAGEYGEAPGTGHRL
VLGHESLGRVRQAPTGSGFRPGDLVAGVVRRPDPEPCGACAHGEFDMCRNGRYTERGIKG
HHGYASERWTVDADYAVRVDDELGELGVLVEPASVVAKAWEQIDRIGARSWFEPARVLVT
GAGPIGLLAALLATQRAGADLDVHVLDQVTDGPKPELVTGLGATYHHRGLDDVADRIRPD
VIVEATGAGPVVLDAMRRNAACGIVCLTGVSSGGRRFEIDAGALNRAIVLENDVVFGSVN
ANLRHYRLATEALAKADPAWLAGVITRRVPLAEAATAFTTRRDDVKVVLTLSDQPS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcgttgaccgtcgtcccgggtgagcgggactcactcgaggtgagcgaactgccc
gaaccggaacccggtccgggtgacctgctggtggacgggatcgccgtcggggtgtgcggt
accgacaaggacatcgtcgccggtgaatacggcgaggcgcccggcaccggccaccggctg
gtgctcggacacgaatcgctcggccgcgtgcggcaggcacccaccgggagcgggttccgg
ccgggcgacctggtcgccggggtggtgcgcaggccggaccccgaaccctgcggtgcctgc
gcgcacggtgagttcgacatgtgccgcaacggccgctacaccgagcgcggcatcaagggc
caccacggttacgccagtgaacggtggactgtcgacgcggactacgccgtccgcgtcgac
gacgaactcggtgagctgggcgtgctcgtggagcccgcctcggtggtggccaaggcctgg
gagcagatcgaccggatcggcgcccgttcctggttcgagcccgcccgcgtgctggtcacc
ggtgccgggccgatcggattgctggccgcgctgctggccacccagcgcgccggtgccgat
ctcgacgtgcacgtgctcgaccaggtgaccgacggtcccaagccggaactggtcaccggc
ctcggcgcgacgtaccaccaccggggcctcgacgacgtcgccgaccggatccggccggac
gtcatcgtcgaggccaccggcgccggtccggtggtgctggacgcgatgcgccgcaacgcc
gcctgcggcatcgtctgcctgaccggcgtctcctcgggaggcaggcggttcgagatcgac
gccggtgcgctgaaccgggccatcgtgctggagaacgacgtggtgttcggctcggtcaac
gccaacctccgccactaccggctcgccaccgaggcactggccaaggcggacccggcctgg
ctggccggggtgatcacccgccgggtgccgctggcggaagcggccaccgccttcaccacc
cggcgggacgacgtcaaggtggtgctcaccctcagcgatcagccgagctga

DBGET integrated database retrieval system