KEGG   Amycolatopsis albispora: A4R43_14310Help
Entry
A4R43_14310       CDS       T05547                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
aab  Amycolatopsis albispora
Pathway
aab00220  Arginine biosynthesis
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
aab01130  Biosynthesis of antibiotics
aab01230  Biosynthesis of amino acids
Module
aab_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A4R43_14310
Enzymes [BR:aab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     A4R43_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AXB43568
UniProt: A0A344L694
Position
complement(3104821..3105759)
Genome map
AA seq 312 aa AA seqDB search
MPRHFLRDDDLTPDEQLAVLDLADRLKAAPLSSRALEGKSVAAIFEKNSTRTRLSFDVGI
AQLGGHPVIVDGRSMQLGREETIEDTSRVLSRYVDAVVWRTFAQKRIDAMASVSRVPVIN
ALTDEFHPCQVLTDLQTIRERKGKLAGLTMVYLGDGANNMAHSLLLGGTTAGMNVRVVSP
EGFQPDQQVMLDAKHRASETGGSATVFTDPHAAVDGADVLVTDTWTSMGQENDGLDRVGP
FRSLQVNAALLERAAPEAIVLHCLPAHRGWEITDEVLDGPASAVWDEAENRLHAQKALLV
WLLENSRDERRR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcacttcctccgggacgacgacctcacccccgacgagcagctcgccgtgctc
gacctcgccgaccggctcaaggccgctccgctcagctcgcgcgcgctggagggcaagtcg
gtcgcggccatcttcgagaagaactcgacgcgcacccggctgtccttcgacgtcggcatc
gcgcagctcggcgggcacccggtgatcgtcgacggccggtccatgcagctcggccgtgag
gagaccatcgaggacacctcgcgggtgctctcgcgctacgtcgacgcggtggtctggcgg
accttcgcgcagaagcgcatcgacgcgatggcctcggtctcccgcgtcccggtgatcaac
gcgctgaccgacgagttccacccgtgccaggtgctcaccgatctgcagaccatccgcgag
cgcaagggcaagctcgccgggctgaccatggtctacctcggcgacggcgccaacaacatg
gcgcattcgctgctgctcggcggcaccacggccggcatgaacgtgcgcgtggtctcgccg
gagggcttccagccggaccagcaggtgatgctcgacgccaagcaccgcgccagcgaaacc
ggcggcagcgcgaccgtgttcaccgatccgcacgccgcggtcgacggcgccgacgtgctg
gtcaccgacacctggacctcgatggggcaggagaacgacgggctggaccgggtcggcccg
ttccgctcgctccaggtcaacgcggccctgctggaacgcgccgcgccggaggcgatcgtg
ctgcactgcctgcccgcgcaccgcggctgggagatcaccgacgaggtgctcgacggcccg
gccagcgcggtgtgggacgaggcggagaaccggctgcacgcgcagaaggcgctgctggtc
tggctcctggaaaactcgcgcgacgagcgacgccgatga

DBGET integrated database retrieval system