KEGG   Amycolatopsis albispora: A4R43_15340Help
Entry
A4R43_15340       CDS       T05547                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
aab  Amycolatopsis albispora
Pathway
aab00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    A4R43_15340
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     A4R43_15340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR ApbA THF_DHG_CYH_C Epimerase Shikimate_DH NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AXB43731
UniProt: A0A344L6Q7
Position
complement(3338612..3339400)
Genome map
AA seq 262 aa AA seqDB search
MILDRFRLTGRAAVVTGAGRGIGAATAVALAEAGADVVLSARTADQLREIAAQVEAAGRR
AEVVPADLSDPAAAAALADAATGAFGRLDIVVNNVGGTLPRPLLETSPRFLEEAFRFNVS
TAHALTRAAAPAMLAAGGGAVVNISSALGRVAGRGYLAYGTAKAALAHYTRLAAADLAPK
IRVNAVAVGTVLTSALEVVAANPELKGRMEQATPLRRLGEPEDIAAAVLYLTSPAGAYVT
GKLLEVDGGLQAPNLDLGLPDL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgaccgcttccggctgaccggacgggccgccgtggtgaccggcgcgggccgt
ggcatcggcgccgcgaccgcggtggcgctggccgaagccggtgccgacgtggtgctctcc
gcccgcaccgcggaccagttgcgcgagatcgcggcccaggtcgaagccgcgggccgccgg
gcagaggtggtgcccgccgatctcagcgacccggcggccgccgccgcgctggccgatgcg
gccaccggcgccttcggcaggctcgacatcgtggtgaacaacgtcggtggcaccctgcct
cggccgttgctggagacttcgccgcgctttctcgaagaggccttccggttcaacgtttcg
accgcgcacgcgctgacccgcgccgcggccccggcgatgctggcggccggcggcggtgcc
gtcgtcaacatctcctcggcgctgggccgggtcgccgggcgcggttatctcgcgtacggc
accgcgaaggccgcgctcgcgcactacacgcggctcgccgcggcggacctcgcgccgaag
atccgggtgaacgcggtcgccgtcggcacggtgctgacctccgcgctcgaggtggtcgcg
gccaacccggaactcaaggggcggatggagcaggccaccccgctgcggcggctcggcgag
ccggaggacatcgcggccgcggtgctctacctgacctcgccggccggcgcctacgtcacc
ggcaagctgctcgaagtggacggcgggctgcaggcgcccaacctggacctcggcctgccg
gacctgtga

DBGET integrated database retrieval system