KEGG   Amycolatopsis albispora: A4R43_19155Help
Entry
A4R43_19155       CDS       T05547                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
aab  Amycolatopsis albispora
Pathway
aab00260  Glycine, serine and threonine metabolism
aab00630  Glyoxylate and dicarboxylate metabolism
aab00670  One carbon pool by folate
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
aab01130  Biosynthesis of antibiotics
aab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A4R43_19155
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A4R43_19155
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A4R43_19155
Enzymes [BR:aab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     A4R43_19155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AXB44377
UniProt: A0A344L8K3
Position
complement(4155800..4156888)
Genome map
AA seq 362 aa AA seqDB search
MTKKSPLHEVHTGLGALFTDFAGWSMPVRYASELAEHKAVREAAGLFDLSHMAEIELTGP
EAARALDHALVGKLSAVSVGRARYSMLCAESGGVLDDLVVYRLAEEKYLVVANAGNAAVV
AEALRERASGYDTEVTDRSAEVALIAVQGPNSPAIVGAVCDADLTALKYYASVPTTVAGH
EVLLARTGYTGEDGFELYVDAAVAPEIWGVLAEAGQPHGLVPAGLACRDTLRLEAGMPLY
GNELSTELTPFEAGLGRVVKFDKEEDFVGKAALARRRDAGAEQVLVGLTGTGRRAPRHGY
SVLDGETVVGEITSGALSPTLGYPIAMAYVPPALSDPGAKLSVDIRGRVEPVEVVALPFY
QR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagaagtcccccttgcacgaggtccacaccggactcggcgcgttgttcaccgat
ttcgccggctggtcgatgccggtgcggtacgccagcgaactggccgagcacaaggccgtg
cgtgaggcggccggcctgttcgacctctcgcacatggccgagatcgagctgaccgggccg
gaggccgcccgcgcgctcgaccacgcgctggtcggcaagctgtccgcggtttcggtcggc
cgggcgcgctacagcatgctgtgcgcggaatccggtggggtgctggacgatctggtcgtc
taccgcctggcggaggagaagtacctggtggtggcgaacgcgggcaacgcggccgtggtc
gccgaagccctgcgcgagcgggcttccgggtacgacaccgaggtgaccgaccggtccgcc
gaggtcgcgctgatcgcggtgcagggcccgaattcgcccgcgatcgtcggtgccgtctgc
gacgcggacctgaccgcgctgaagtactacgcctcggtgccgaccacggtcgccgggcac
gaagtgctgctggcccgcaccggctacaccggcgaagacggcttcgagctgtacgtggac
gccgccgtcgcgccggagatctggggtgtgctggccgaggccgggcagccgcacgggctg
gtgcccgccgggctcgcctgccgtgacacacttcggctcgaagccggaatgccgttgtac
ggcaacgaactcagcaccgagctgacaccgttcgaggccgggctgggccgcgtggtcaag
ttcgacaaggaagaggacttcgtcggcaaggcggcgctggcgcggcgccgcgacgccggg
gcggagcaggtgctggtcgggctgaccggcaccggccgccgcgcgccccggcacgggtat
tccgtgctggacggcgaaaccgtggtcggtgagatcaccagcggcgcgctttcccccacc
ctgggctatccgatcgcgatggcgtacgtgccaccggcattgtcggacccgggtgccaaa
ctctccgtcgacatccgaggccgcgtcgaacccgtcgaggtcgtcgccctgccgttctac
cagcgctga

DBGET integrated database retrieval system