KEGG   Amycolatopsis albispora: A4R43_28340Help
Entry
A4R43_28340       CDS       T05547                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
aab  Amycolatopsis albispora
Pathway
aab00310  Lysine degradation
aab01100  Metabolic pathways
aab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    A4R43_28340
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     A4R43_28340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 Pyr_redox Amino_oxidase FAD_binding_2 HI0933_like FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C GIDA NAD_binding_7 TrkA_N UDPG_MGDP_dh_N ApbA Sacchrp_dh_NADP FAD_oxidored Thi4
Motif
Other DBs
NCBI-ProteinID: AXB45907
UniProt: A0A344LCY3
Position
6067301..6068482
Genome map
AA seq 393 aa AA seqDB search
MRKNVVVIGGGIIGLATAWELTRRGEHVTVLEKEDHWAAHQTGHNSNVVHAGLYYKPGSF
KARMSVAGNRSIIDFAKEHGVGVEVCGKLVVATSEAELPALGVLAQRAEANGVPAKLISA
DEARDYEPEVACVSALRVESTGIIDFPGVCRALVRLLEEAGADLRLGTPALGIRSRNSKV
EVATGTDVLRADALVNCAGLHSDRIARLAGLTPKARIVPFRGEYYELREDRRHLVRGLIY
PVPDASLPFLGVHLTRMLDGSVHAGPNAVLALRREGYRWGDISPADLAEVARFPGIWRLA
KKYAYPIGLDEVRRSFSKKRFANSLAKLVPAVRPEDIVRHGSGVRAQALLPDGSMVDDFL
IETAPNQVHVLNAPSPAATSALEIAKHVADQVT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaagaacgttgttgtcatcggcggcgggatcatcgggctggccacggcgtgggaa
ctgacccgccgcggcgagcacgtcaccgtgctggagaaggaagaccactgggcggcccac
cagaccgggcacaactcgaacgtggtgcacgccgggttgtactacaagccgggctcgttc
aaggcgcggatgtcggtggcgggcaaccgctccatcatcgacttcgccaaggagcacggc
gtcggcgtcgaggtctgcggcaagctggtggtggccacctccgaagccgaactgcccgcg
ctgggcgtgctggcccagcgcgccgaggccaacggcgtgccggcgaagctgatcagcgcc
gacgaggcccgcgactacgagcccgaggtcgcctgcgtcagcgcgctgcgggtggagtcc
accggcatcatcgacttccccggggtctgccgcgcgctggtgcgcctgctcgaagaagcc
ggggccgacctgcggctgggcacgcccgcgctgggcatccgcagccggaactcgaaggtg
gaggtcgccaccggcaccgacgtgctgcgggccgacgcgctggtcaactgcgccgggctg
cactcggaccggatcgcgcggctggccgggctgacgccgaaggcacgcatcgtgccgttc
cgcggtgagtactacgaactgcgcgaggaccgccgccacctggtgcgcgggctgatctac
ccggtgccggacgcgtcactgccgttcctcggcgtgcacctgacccggatgctcgacggc
agcgtgcacgccgggccgaacgcggtgctggcgctgcgccgcgagggctaccgctggggt
gacatctcgcccgccgacctggccgaggtggcgcggttccccggcatctggcggctggcg
aagaagtacgcctacccgatcggcctggacgaggtgcggcggtcgttctcgaagaagcgg
ttcgcgaacagcctggcgaagctggtgcccgcggtgcggccggaggacatcgtgcgccac
ggttcgggcgtgcgggcgcaggcgctgctgccggacggctcgatggtcgacgacttcctg
atcgagaccgcgccgaaccaggtgcacgtgctcaacgccccctccccggcggcgacgagc
gcactggagatcgccaagcacgtcgcggaccaggtcacgtga

DBGET integrated database retrieval system