KEGG   Amycolatopsis albispora: A4R43_36040Help
Entry
A4R43_36040       CDS       T05547                                 

Definition
(GenBank) bifunctional RNase H/acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
aab  Amycolatopsis albispora
Pathway
aab00860  Porphyrin and chlorophyll metabolism
aab01100  Metabolic pathways
aab03030  DNA replication
Module
aab_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A4R43_36040
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    A4R43_36040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aab03032]
    A4R43_36040
Enzymes [BR:aab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     A4R43_36040
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     A4R43_36040
DNA replication proteins [BR:aab03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     A4R43_36040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AXB47193
UniProt: A0A344LGL9
Position
complement(7690960..7692051)
Genome map
AA seq 363 aa AA seqDB search
MLVEADGGSRGNPGPAGYGAVVKDADTGEVLAERQAGLGVATNNFAEYSGLLAGLAAAAE
LGASTVDVRMDSKLVVEQMSGRWKIKHPDLRPLAEQARELAARFDRVTYAWIPRADNSYA
DRLANEAMDTQAGTATTKTKTDRVSPAKWSGAQGTPTKFLLLRHGQTEMSVDRRYSGRGD
VPLTEHGQRQVAAAAKRIAAMDGLVVDGEPAPIIASPLLRTQQTAQAVADALGGRVETHQ
GLIETDFGSWEGLTFTEAADRDPELHARWISDSSVPAPDGESFDAVHRRVRAVRDDLVDR
FAGRTVVVVSHVTPIKSLLRLGLDAGPSLLFRLHLDLASLSIVEFYPDGNASVRLANDIS
HLS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtcgaagccgatggcgggtcgcggggcaacccggggccggccggctacggcgcg
gtggtgaaggacgccgacaccggcgaggtgctcgccgagcgccaagccgggctcggcgtg
gcgaccaacaacttcgccgagtactccggcttgctggccgggctggcggccgccgccgag
cttggtgcgtccactgtggacgtccggatggactcgaagctggtggtcgagcagatgtcc
gggcgctggaagatcaagcacccggatctgcggccgctggccgagcaggccagggaactg
gccgcgcgcttcgaccgcgtgacctacgcatggatcccgcgggcggacaactcgtacgcc
gaccggctcgccaacgaggcgatggacacccaggccgggacggcgacaacaaaaacgaag
acggaccgggtgtccccggcgaagtggagcggcgcgcagggcacaccgacgaagttcctc
ctgctgcgccacggccagacggagatgtcggtggaccgccggtactccgggcgcggcgac
gtgccgctgaccgagcacggccagcgccaggtggccgccgcggcgaagcgcatcgccgcg
atggacgggctggtcgtcgacggggagcccgcgccgatcatcgcgtcaccgctgctgcgc
acccagcagaccgcgcaggcggtggcggacgcgctcggcgggcgggtggaaacgcaccag
ggcctgatcgagacggacttcggcagctgggaaggcctgaccttcaccgaggccgccgac
cgcgaccccgagctgcacgcgcgctggatcagcgactcctcggtgcccgcgccggacggg
gagagcttcgacgcggtgcaccggcgggtgcgcgcggtgcgcgacgacctcgtcgaccgg
ttcgccgggcggaccgtggtggtggtcagccacgtcacgccgatcaagtcactgctgcgg
ctgggcctggacgccgggccgtccctgctgttccggctgcacctggacctggcgtcgctg
tccatcgtcgagttctaccccgacggcaacgcctccgtccgactggcgaacgacatctcc
cacctgagctga

DBGET integrated database retrieval system