KEGG   Amycolatopsis albispora: A4R43_38270Help
Entry
A4R43_38270       CDS       T05547                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aab  Amycolatopsis albispora
Pathway
aab00220  Arginine biosynthesis
aab00330  Arginine and proline metabolism
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
aab01130  Biosynthesis of antibiotics
aab01230  Biosynthesis of amino acids
Module
aab_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A4R43_38270
   00330 Arginine and proline metabolism
    A4R43_38270
Enzymes [BR:aab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A4R43_38270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AXB47590
UniProt: A0A344LHR6
Position
8224855..8225673
Genome map
AA seq 272 aa AA seqDB search
MRIHVVPQTQGALTPRAAELADGARALGALAAEVLGVLATEVTIDPAGDPSKVDGIANRA
ALVRNRAGQLAALEAPEAKVLTIGGDCAVELAPIGVARFRHGAGLGVAYFDAHPDLNTAA
SSPSGAYHGMVLRSLFGEGDPEFAASPALEPGRAVLVGTRSIDPAEQEAIDRGLATVAPA
AELPKRLRESGAESVYLHLDLDVLDPAEFTGINYPEPDGLSVPELVSAIDSLAEFEVVGA
AVTECVTADREELRKLVPVLEAVGRVMASGPR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtattcacgttgttccgcagacccagggcgcgctgaccccgcgtgccgccgagctc
gccgacggcgcccgcgcgctcggcgcactcgccgccgaggtgctcggggtgctcgccacc
gaggtgaccatcgatccggccggcgatccgtccaaagtggacggcatcgccaaccgcgcc
gcgctggtgcgcaaccgggcgggccagctggccgcgctggaggcgcccgaggcgaaggtg
ctcaccatcggcggcgactgcgccgtcgaactcgcgccgatcggtgtggcccgcttccgc
cacggcgccgggctgggtgtcgcctacttcgacgctcaccccgacctcaacaccgcggcg
agttccccgtcgggcgcgtaccacggcatggtgctgcggtcgctgttcggcgagggcgat
ccggagttcgcggcttcgcccgcgctggaaccgggccgcgcggtgctggtcggcacccgc
tcgatcgacccggcggagcaggaggccatcgaccggggcctggccaccgtggcaccggcc
gccgagttgcccaaacgcctgcgcgagagcggcgccgagtccgtctacctgcacctcgat
ctcgacgtgctcgacccggccgagttcaccgggatcaactacccggagccggacgggctg
agcgtgcccgagctggtttccgccatcgactcgctggccgagttcgaggtggtcggcgcg
gcggtcaccgaatgcgtcaccgccgaccgcgaggaactgcgcaagctcgtcccggtgctg
gaggcggtcgggcgcgtcatggcttctggcccacgctga

DBGET integrated database retrieval system