KEGG   Amycolatopsis albispora: A4R43_41770Help
Entry
A4R43_41770       CDS       T05547                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aab  Amycolatopsis albispora
Pathway
aab00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A4R43_41770
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A4R43_41770
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A4R43_41770
    1.1.1.-  
     A4R43_41770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc ADH_zinc_N_2 Glu_dehyd_C Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AXB48166
UniProt: A0A344LJE2
Position
9108061..9109110
Genome map
AA seq 349 aa AA seqDB search
MRAVVYRGREEVAVEEVPEPDCGPEQVKIKVAHNGICGTDLHEYYAGPIFVPTAEPHPLT
GASAPVVLGHEFAGTVVETGSEVSGLRKGDRVAVEPVYRCDTCPACLDGHYNICRTIGFH
GLSCDGGMAEYTVVPARMAHKLPASVSDELGALVEPMSVAYHAAGLGEVGPGSSAVVFGA
GPIGIGVWFALRGLGVEKITVVEPSPVRRAALLALGADDVLDPADTDPVAHVRDRTGGRG
ADAAYDAAGVRAAVDTALDCVGHRKHLVSVAIYERPLETSLIKLVMSESGIRGSLCYTAR
DYAAVIDLMAAGHYDTTGWVEHIPLDKVVEEGFTALHAGLKMKVLVDPV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggtggtctaccgcggccgggaagaggtcgccgtcgaagaggtgcccgagccg
gactgcgggccggaacaggtcaagatcaaggtggcgcacaacgggatctgcggcaccgac
ctgcacgagtactacgccgggccgatcttcgtgccgaccgccgagccgcacccgctgacc
ggcgcgagcgcgccggtggtgctcgggcacgagttcgcgggcacggtggtggaaaccggg
agcgaggtcagcgggctgcgcaagggcgaccgggtggcggtcgagccggtgtaccggtgc
gacacctgcccggcctgcctcgacgggcactacaacatctgccgcacgatcggcttccac
ggcctgtcctgcgacggcggcatggcggagtacaccgtggtgcccgcgcggatggcgcac
aagctgcccgcctcggtgagcgacgagctgggcgcgctggtggagccgatgtcggtggcc
taccacgcggccgggctcggtgaggtcgggccgggctcgtcggcggtggtgttcggggcc
gggccgatcggcatcggtgtctggttcgcgctgcgcgggctgggcgtggagaagatcacc
gtggtggagccgtcgccggtgcgccgcgcggcgcttctcgcgctcggcgcggacgacgtg
ctcgacccggcggacaccgatccggtggcgcacgtgcgggaccgcaccggcggccggggc
gcggacgcggcctacgacgcggccggggtgcgcgcggcggtcgacaccgcgctcgactgc
gtcgggcaccgcaagcacctggtgtcggtggcgatctacgaacggccgctggaaaccagc
ctgatcaagctggtgatgtcggagagcgggatccgcggttcgctgtgctacaccgcgcgc
gactacgcggcggtgatcgacctgatggcggccgggcactacgacaccaccggctgggtc
gagcacatcccgctggacaaggtggtcgaggagggcttcaccgcgctgcacgccgggctg
aagatgaaggtgctggtggacccggtctga

DBGET integrated database retrieval system