KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0128Help
Entry
Aaci_0128         CDS       T00985                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00450  Selenocompound metabolism
aac00970  Aminoacyl-tRNA biosynthesis
aac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Aaci_0128
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Aaci_0128
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aac01007]
    Aaci_0128
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aac03016]
    Aaci_0128
Enzymes [BR:aac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Aaci_0128
Amino acid related enzymes [BR:aac01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Aaci_0128
Transfer RNA biogenesis [BR:aac03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Aaci_0128
 Prokaryotic type
   Other AARSs
    Aaci_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: ACV57192
UniProt: C8WQL4
Position
143423..145375
Genome map
AA seq 650 aa AA seqDB search
MKPTFYVTTPIYYPNDKLHIGHAYTTVAADAIARYKRLRGYDVFFLTGTDEHGLKIQQRA
EQAGLEPKAFLDPIIAWIQDLWKKLDISYDDFIRTTEARHERVVEQIFERLLQQGDIYLS
EYQGWYCTPCESYWAERELVDGKCPQCGREVQFVREESYFFRMSKYVDRLLQYYEENPGF
IEPVSRKTEMIKNFIEPGLQDLCVSRTSFDWGVHVPSNPKHVVYVWLDALVNYISAIGYL
SDDADERVKFERYWPADVHVVGKDIVRFHAVYWPIILMALGLPLPKKVFGHGFFLVKGGK
MSKSKGNVIDPLSLVDRYGRDAFRYFLLREIPFGQDGTFTPEGMVERLNYDLANDFGNLV
HRTAAMLNRFNDGVVPAPGSLTDVDRALRDLAAEVKAKVEENMDQLQFSVALAELWNLVR
AANKYIDDCQPWKLNKEGERERLATVLYHMVEAIRVSAILVQPFMTDAPKAIREQFGWGD
EAFAWDSAEMGLGPSGQTVAEREPLFPRLDVEKEIEILTEMTGSAQQANAESKAEEARTV
VHKDEITIDVFDKVELRVGQVLACEKHPNADKLLVLQVDLGGETRQIVSGIAKYYQPEEL
VGKKVVVVANLKPVKLRGQDSLGMILCASEGDTLSIVTVPDNMPNGAIVK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgaccttctacgtcacaacgcccatctattatccgaacgacaagcttcacatc
ggccacgcgtacaccaccgtggccgccgacgccatcgcgcgttacaagcgcctgcggggc
tacgacgtgttcttcctcaccggcaccgacgagcacggcctcaagatccagcagcgcgcg
gagcaggctgggctcgagccgaaggcgtttctggatcccatcatcgcctggattcaggac
ctgtggaagaagctcgacatctcctacgacgacttcattcgaaccacggaggcgcgccac
gagcgcgtggtcgagcagatcttcgagcgcctgcttcagcagggcgacatctacctctcg
gagtatcagggctggtactgcacgccctgcgagtcgtactgggcggagcgggagctcgtg
gacggcaagtgtccgcagtgcgggcgcgaggtccagttcgtccgcgaagagtcgtatttc
ttccgcatgagcaaatacgtggatcgcctgctgcaatactacgaggagaacccgggcttc
atcgagccggtctcgcgcaagacggagatgatcaagaacttcatcgagcccgggctgcag
gacctctgcgtctcgcgcacctcgttcgattggggcgtgcacgtaccctccaatccgaag
cacgtggtgtacgtgtggctcgacgcgctcgtcaactacatctcggccatcggctacctc
tcggacgacgcggatgagcgcgtgaagttcgagcgctactggcccgcggacgtgcacgtc
gtcggcaaggacatcgtccgcttccacgcggtctactggcccatcatcctgatggccctt
ggcctgcccctgccgaagaaggtgttcggccacggattcttcctcgtcaagggcggcaaa
atgtcgaagtcgaaggggaacgtgatcgacccgctctcgctcgtggaccggtacggccgc
gacgcgttccgctacttcctgctgcgcgagatcccgttcgggcaggacgggacgttcacg
cccgagggcatggtcgagcggctcaattacgatctcgccaacgacttcggcaatctcgtc
catcgcaccgccgccatgctgaaccggttcaacgacggcgtggtgcccgcgccgggatcg
ctcacggacgtcgatcgcgcccttcgcgacctcgcggcggaggtcaaggcgaaggtcgag
gagaacatggaccagctccagttctcggtggcgctcgcggagctctggaacctcgtgcgc
gcggccaacaagtacatcgacgactgccagccgtggaagctgaacaaggagggggagcgg
gagcggctcgcgacggtgttataccatatggtcgaggccattcgcgtctccgccattctc
gtgcagccgttcatgacggatgcgccgaaggccatccgcgagcagttcggttggggagac
gaggcgtttgcgtgggacagcgccgagatgggcctcggcccgagcggtcaaacggtggcc
gagcgggagcctttgttcccgagactcgatgtggaaaaggagattgagatcttgacggag
atgacaggttcggctcagcaggccaacgcggaatcgaaggccgaagaggcaaggacggtg
gtgcacaaggacgagatcaccatcgacgtcttcgacaaagtggaactgcgcgtcggccag
gtgctcgcctgcgaaaagcacccgaacgccgacaagctgctcgtgcttcaggtcgatctc
ggcggcgaaacgcgccaaattgtgtccggcattgcgaagtactatcagcccgaggagctc
gtgggcaaaaaggtggtcgtcgtggccaacctgaagcccgtgaagttgcgcggccaggac
tcgctcggcatgatcctctgcgcgtccgagggggatacgctctccatcgtgacggtgccg
gacaacatgccgaacggagcgattgtgaagtga

DBGET integrated database retrieval system