KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1022Help
Entry
Aaci_1022         CDS       T00985                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00260  Glycine, serine and threonine metabolism
aac00750  Vitamin B6 metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01230  Biosynthesis of amino acids
Module
aac_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aaci_1022
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Aaci_1022
Enzymes [BR:aac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Aaci_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV58060
UniProt: C8WVD8
Position
1092867..1093940
Genome map
AA seq 357 aa AA seqDB search
MEHGVRPGWPGILEVYRSFLPITEGTPRLTLHEGNTPLVYADKLSERLECHVYLKFEGAN
PTGSFKDRGMVVAVAKAKEAGKRVVICASTGNTSASAAAYAARAGLEAVILIPHGYVALG
KLAQAVQYGARIVAIRGNFDQALAIVREVADPLGMEVVNSINPYRLMGQQTAAFEICDAL
GRAPDALYIPVGNAGNISAYWMGFTRYYEEKRIDARPKMFGFEAEGAAAIVRGEPIAHPE
TFATAIRIGNPASWDKAVRAAQESGGAIDCVTDEAIAEAYRLIAQEGVFAEPASAASVAG
LLKRHREGGVTRGETVVCVLTGNGLKDPDSAMRLASQEALVVDGDPDAVRRALGGLS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaacatggcgtccgcccggggtggccgggcattctggaagtgtaccgaagtttcctt
cccatcaccgagggcacgccgcggctcacgctgcacgaggggaacacgccgctcgtctac
gcggacaagctgagcgagcggctcgagtgccacgtgtacctcaagttcgaaggcgcgaat
ccgacgggatcgttcaaagaccggggcatggtggttgcggtcgcgaaggccaaggaggcg
ggcaagcgcgtcgtcatctgcgccagcacgggcaacacgtccgcgtcggcggccgcctac
gcagcgcgcgcggggcttgaggcggtcatcctcatcccgcacggctacgtcgcgctcggc
aaactggcgcaggccgtacagtacggcgcacgcattgtcgcgattcgcggcaatttcgat
caggcgctcgccattgtgcgcgaggtcgcggatccgctcggcatggaagtggtgaattcc
atcaatccgtatcggctcatgggccagcagacggctgcgttcgagatctgcgacgcgctt
gggcgcgcgccagacgcgctctacatccccgtgggcaacgcgggcaacatctcggcgtac
tggatgggattcacgcgctattacgaggagaagcgcatcgatgcgcgccccaagatgttc
ggctttgaggccgagggcgcggcggctatcgtgcggggagaacccatcgcccatcccgag
acctttgcgacggccattcgcatcggcaacccggcgtcctgggacaaggcggtccgggcc
gcacaggagtccggcggcgccatcgactgcgtgacggatgaggccatcgccgaggcgtac
cggctcatcgcgcaggagggcgtgttcgccgagccggcttcggcggccagcgtcgcaggg
ctgttgaagcgccaccgcgagggcggcgtgacccgcggtgagaccgtggtgtgcgtgttg
acgggaaacggcctgaaggatccggacagcgccatgcgcctcgcctcgcaggaggccctc
gtggtcgacggcgatcccgacgcggtgcggcgcgcgctgggtgggctatcatga

DBGET integrated database retrieval system