KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2058Help
Entry
Aaci_2058         CDS       T00985                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00071  Fatty acid degradation
aac00072  Synthesis and degradation of ketone bodies
aac00280  Valine, leucine and isoleucine degradation
aac00310  Lysine degradation
aac00362  Benzoate degradation
aac00380  Tryptophan metabolism
aac00620  Pyruvate metabolism
aac00630  Glyoxylate and dicarboxylate metabolism
aac00640  Propanoate metabolism
aac00650  Butanoate metabolism
aac00900  Terpenoid backbone biosynthesis
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
aac01212  Fatty acid metabolism
aac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aaci_2058
   00630 Glyoxylate and dicarboxylate metabolism
    Aaci_2058
   00640 Propanoate metabolism
    Aaci_2058
   00650 Butanoate metabolism
    Aaci_2058
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Aaci_2058
   00072 Synthesis and degradation of ketone bodies
    Aaci_2058
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aaci_2058
   00310 Lysine degradation
    Aaci_2058
   00380 Tryptophan metabolism
    Aaci_2058
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aaci_2058
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aaci_2058
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Aaci_2058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aac04147]
    Aaci_2058
Enzymes [BR:aac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Aaci_2058
Exosome [BR:aac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aaci_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACV59068
UniProt: C8WQC3
Position
complement(2108991..2110178)
Genome map
AA seq 395 aa AA seqDB search
MQDVVIAGAVRTPIGTFQGSLSPLSAPDLGAAVIRESLRRAGVEAGAVDEVVMGNVLQAG
VGQNPARQAAMRAGLPEDIPATTVNMVCGSGLKSVMLAAQAIRAGDADVLVAGGMESMSN
APYLLPGAREGYRMGHREVVDSMIRDGLWCAFCDIHMGVTAENVANRHGISREDQDRFAL
QSQMRAKEAMEAGRFKDEIVPVSVPRRKGEPTLVDCDEHPRPDTTYEALAKLRPAFQADG
TVIAGNSSGINDGAAAMLVLARDRAEALGVKPMARIVSYASVGLDPSVMGLGPIEATRRA
LGRAGLSVEDLDLIEANEAFAAQALAVARELSFPDDKLNVNGGAIALGHPIGASGARILV
TLLYELERRGGRFGLATLCIGGGQGVAMVVERMSQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagacgtggtgattgcaggggcagtgcggacgcccatcggaacgttccagggaagt
ctctcgcccctttcggcgccggatctcggtgcggccgtgatccgggagtcgctgcggcgc
gcgggagttgaggccggggccgtggacgaagtcgtgatgggcaacgtgctgcaggcgggc
gtcggccagaatccagcgcggcaagcggcgatgcgcgcggggctgccggaagacatcccg
gcgacgacggtgaacatggtgtgcggatcgggcctaaagtcggtcatgctcgcggcgcag
gccattcgcgccggggacgcggacgtcttggtggcgggcggcatggagtcgatgtcgaac
gcgccgtacctgcttccaggggcgcgcgagggctaccgcatgggccatcgcgaagtggtc
gacagcatgatccgggatggcttgtggtgcgcgttttgcgacatccacatgggcgtcact
gccgaaaacgtggcgaatcgccacggcatcagccgcgaggatcaggaccgattcgcgctg
cagagccagatgcgcgccaaggaagcgatggaggcaggccggttcaaggacgagatcgtg
cccgtctccgtgccgcggcggaagggcgagccgaccttggtcgattgcgacgaacatccg
cgtcccgacacgacgtacgaggcgctggcgaagcttcggcccgcgtttcaggcggacggc
accgtgatcgccggcaacagctcgggcatcaacgacggcgcggcggccatgctggtgctc
gcccgggatcgcgccgaggcgttgggcgtgaagccgatggcgcggatcgtgagctacgcg
agcgtgggcttggatccgagcgtgatgggcctcggtcccatcgaggcgacgcgccgagcg
ctcggccgggcggggctttccgtggaagacctcgacctcatcgaggcgaatgaggcgttc
gccgcccaggcgctcgcggtggctcgggaactgtcgttcccggatgacaagttgaacgtg
aacggcggcgccatcgcgctcggccaccccatcggcgcgagcggtgcccggatcttggtc
acgctgctttacgagctcgagcgccgcggcggccgtttcggcctcgccacactgtgcatc
ggcggcggacagggcgtggccatggtcgtggagcgcatgtcgcagtga

DBGET integrated database retrieval system