KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2142Help
Entry
Aaci_2142         CDS       T00985                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00020  Citrate cycle (TCA cycle)
aac00620  Pyruvate metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
Module
aac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aaci_2142
   00620 Pyruvate metabolism
    Aaci_2142
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Aaci_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACV59151
UniProt: C8WQY2
Position
complement(2202972..2204531)
Genome map
AA seq 519 aa AA seqDB search
MSTVWFAGRIKVRPHLHKDGIDMDGKTRSDVALIGGGIMSATLGTLFRQLAPDWTITVFE
RLDEVAVESSNEWNNAGTGHSALCELNYTVEQPDGSIDISKAIQVNEQFLVSRQFWSFLV
RQGIIEHPRDFIVPVPHMSFVQGETNVAFLKKRHQLLSQHPLFQGMEYSEDPERLREWIP
LMMKDRKLDRPIAATWIASGTDVNFGALTRMLFQYLEREGVDVQCGKEVQDLKRTRDGMW
QLRVRDVKTGATYEHVSKFVFVGAGGWSLLLLQKSGIDEGKGIGGFPVSGLFMVCENPEI
VRQHRAKVYGKAPVGAPPMSVPHLDSRVIGGREYVLFGPFAGFSPRFLKTGSMLDLLKSV
KLHNLSTLLAAGAKNASLTLYLIRQLMLTKKQRMDELREFVPTARDEDWRLVVAGQRVQV
IKRRPRGELQFGTEVVSARDGSIAALLGASPGASVVVSIMLEVIRKCFPDRLPEWENKIR
EMIPSYGVTLRHRPDLMRSIQAETAEVLGLHRMEARTDA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagtttggtttgcggggcgcatcaaggtgcgcccgcatctgcataaggatggg
atcgacatggacggaaagacgagatcggatgtcgccctgattggcggcggcatcatgagt
gccacgctggggaccttgtttcggcagcttgcgcccgattggaccatcaccgtgttcgaa
cgcctcgacgaggtcgcggtggagagttcgaacgagtggaacaacgcgggcacggggcac
tctgcgctctgcgagctgaactacacggtcgaacagccagacggaagcatcgacatctcc
aaggccattcaggtgaacgagcagttcctggtctctcgccaattttggtcgttcctcgtg
cgacagggcatcatcgaacatccgagagattttatcgtgcctgtgccgcacatgagcttc
gtgcagggcgagacgaacgtggcgtttttgaagaaacggcaccagttgttgtcccagcac
ccgcttttccaagggatggaatactccgaggatcccgagcggctccgggaatggattccg
ctgatgatgaaggatcgcaagctggatcgcccgattgccgctacgtggatcgcgtccggc
acggacgtgaacttcggcgcgctcacccggatgctgttccaatacctggagcgcgaaggc
gtggacgttcagtgcggcaaagaggtccaggacttgaagcgtacgcgcgacggcatgtgg
cagctccgcgtgcgcgatgtgaagacgggcgccacctatgagcatgtgtcgaagttcgtc
ttcgtcggggccgggggatggagtctactgcttctgcagaaatccggcattgacgagggg
aagggcatcggtggcttcccggtgagcggtcttttcatggtctgcgagaatcccgagatt
gtccgccagcaccgcgccaaggtgtatggcaaggcccccgtgggtgcgcctcccatgtcc
gtgccgcacctggattctcgcgtcatcggcggccgagagtatgtcctgttcgggccgttc
gccgggttttcaccgcgctttttgaagacgggctccatgctcgacctactgaagtcggtc
aagcttcacaacctgtcgaccctgctcgccgcgggcgccaagaacgcctcgctgacgctg
tatctcatccgacagctcatgctgacgaaaaagcagcgcatggacgagctgcgcgagttc
gtgcccacggcacgtgatgaggattggcgcctcgttgtcgcgggccaacgcgtccaggtc
atcaagcggcgcccgcgaggcgagctgcagttcggcaccgaggtggtgagcgccagggac
ggatccatcgctgcgctgctcggcgcatcgccgggcgcgtcggtcgtggtgtccatcatg
ctcgaggtcatccgcaaatgtttcccggaccggctgcccgagtgggagaacaagatccgc
gagatgatcccgtcgtacggcgtcacgctgcgccacagacccgatctgatgcgttccatc
caggccgagacggccgaggtgctggggctgcatcggatggaggcccgaacggacgcgtga

DBGET integrated database retrieval system