KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2427Help
Entry
Aaci_2427         CDS       T00985                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00860  Porphyrin and chlorophyll metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
Module
aac_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aaci_2427
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Aaci_2427
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Aaci_2427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 3HCDH_N 2-Hacid_dh_C Pyr_redox_2 Pyr_redox TrkA_N GIDA Glyco_trans_4_4 ApbA F420_oxidored DFP Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACV59433
UniProt: C8WSE8
Position
2487906..2488439
Genome map
AA seq 177 aa AA seqDB search
MSSDRVPIWLKPRGMPCAVIGGGRVGARRAERLARAGAKVTLVSPTLGPEATELVQQDLV
TWIDRAYQPGDLTNFALAVAATDDPAVNAAVRAEARARGIWCNRADDASDSDLDFASVVR
VGEISVSIATDGTKPGLAKSLREALEQDLATGGDTFIRLLRRCADAPGAGKSPPEPP
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcggaccgagtccccatctggctcaagccgcgcggcatgccgtgcgccgtgatc
ggcggcgggcgcgtgggcgcgaggcgcgccgaacggctcgcgagagccggagccaaggtc
accctggtgagcccgacgctcggccctgaagccaccgagctcgtccaacaggacctggtg
acgtggatcgaccgcgcctaccagcccggcgatctcacgaactttgccctcgccgtcgcg
gcgacggacgatccggcggtcaacgccgccgtgcgcgcggaggcgcgtgcgcgcgggatt
tggtgcaatcgggcggacgacgcctccgacagcgatctcgacttcgcgagtgtggtccgc
gtcggcgagatttccgtgtccattgcgacggacgggaccaagcccggcctcgcgaaaagt
ctgcgtgaagcgctggaacaagacctcgcgacgggcggcgacacgttcattcggctgctt
cggcggtgcgccgacgcgccgggcgccggcaagtcgcctcccgagccaccatga

DBGET integrated database retrieval system