KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2626Help
Entry
Aaci_2626         CDS       T00985                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Brite
KEGG Orthology (KO) [BR:aac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Aaci_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACV59630
UniProt: C8WTB6
Position
complement(2704093..2705076)
Genome map
AA seq 327 aa AA seqDB search
MLVVIVLIVLLGLVFDFTNGFHDTANAIATSVSTRALSPRAAVLLAGTMNLIGAMTFTGV
AKTIGGKIADPLKIPHGTIVVLCALVAAIFWNLFTWYFGIPSSSSHALIGGLTGAVIGAA
GFHAVDLAGFTSIIEALITSPICAFVLGFAIMWAFRAVFGWRSPHRVNRVFRVLQCFSAA
AQAFMHGTNDSQKTMGVITFALIAGGYQHTMHVPLWVKTLCAIAMGVGTASGGWRIIKTV
GSKIIKIEPINGFASDLTSSIIIFGFTLFKLPVSSTHVISSAIMGTGAAKRARGVHWNVA
GRILVAWLVTIPMSGLIAAGLTKLALL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctggttgtcattgtgcttatcgtgttgttgggactcgtcttcgactttaccaacggc
tttcacgacaccgcgaacgccatcgcgacgagcgtctcgacgcgggctctgtcgccccgg
gccgctgtgttgctcgccggcaccatgaacctgattggcgccatgaccttcaccggcgtg
gccaagaccatcggcggcaagatcgccgatccgctgaagatcccgcacgggaccatcgtc
gtcctgtgtgcactcgtggccgctatcttttggaatttgttcacatggtattttgggatt
cccagttcctcgtcccacgccctcatcggcgggctgacgggggccgtgatcggcgcggcg
ggttttcacgcggtcgatctcgccggattcacctcgatcatcgaggcgctcatcacgtcg
cccatctgcgccttcgtgctgggcttcgccatcatgtgggcgtttcgcgccgtgttcggg
tggcggtctccgcacagggtgaaccgcgtgttccgcgtgctgcagtgcttttcggcggct
gcgcaggcgttcatgcacggcacgaacgattcgcagaagaccatgggcgtcatcacgttt
gcgctcatcgccggagggtatcagcacacgatgcacgtccccttgtgggtgaagacgctc
tgcgccatcgccatgggcgtcggcacggcttcgggcggctggcggatcatcaagaccgtc
gggtcgaagatcatcaagatcgagcccatcaacgggttcgcctcggatctgacgagttcc
atcatcatcttcggcttcacgctgtttaaactgcccgtgagctcgacgcacgtcatctcg
tcggccatcatgggaacgggcgcggcgaagcgcgcgcgaggcgtgcactggaatgttgcg
gggcgcatcctcgtcgcgtggctggtgacaattccgatgtccgggctcatcgcggcgggg
ctcacgaagctggcgcttctgtga

DBGET integrated database retrieval system