KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2829Help
Entry
Aaci_2829         CDS       T00985                                 

Definition
(GenBank) aminoglycoside phosphotransferase
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Brite
KEGG Orthology (KO) [BR:aac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:aac01504]
    Aaci_2829
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     Aaci_2829
Antimicrobial resistance genes [BR:aac01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    Aaci_2829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1679
Motif
Other DBs
NCBI-ProteinID: ACV59833
UniProt: C8WUL7
Position
complement(2888768..2889688)
Genome map
AA seq 306 aa AA seqDB search
MTVGVPDDWLDVVRSHLPGLAVDRLEVHDEGWDHWVVVVNRAWVFRFARRPDVAKRLCVE
QRVLNHIGHGVQKAGVRVPSPSPVKDERGWVIGSRYPFISGEPLRAAVLDGLDASTSNRI
AEHLGSFLTILHDADVSAFQTQGVPAFQTESFWQQDWREMQDCVLPLLDRDEQRVILARF
GDFFDQALSGTLPRALLHGDLTHAHILYDPRVTEAIGIIDFGDVQIGDPAYDFAGLYWDY
GPAFVRNVLDHYAACLGAWDVHAFCTRVEYLGLRVGLRELLHAVEHHHTRRMREIRTKLR
ASLSPR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgacggttggcgtacccgacgactggctggacgttgtgcgttctcacctcccgggtctc
gctgtggatcggctggaagttcacgacgaaggatgggaccactgggtcgtggttgtgaac
cgcgcttgggtgttccgatttgcccgtcggccagacgtcgcaaagcggctctgcgttgaa
cagcgtgtgctcaaccacattggccatggcgtccaaaaagcaggtgttcgcgtaccgagc
ccgagtcccgtgaaggacgagcgtgggtgggtcattgggagtcgctatccattcatttcc
ggagagcctctccgcgccgcggtgttggacggcctggacgcatcgacgtccaaccgaatt
gccgagcatctgggctccttcttgaccattttgcatgacgccgatgtttccgcgtttcag
acccagggtgtaccggcctttcaaaccgaatccttctggcaacaggattggcgtgagatg
caggattgcgtcttgcccctgctggatcgcgatgagcagcgagtgattcttgctcgattt
ggggactttttcgaccaggccctcagcggcacccttccgagggcgttactccatggcgat
ctcacgcatgcacacatcttgtacgacccgcgcgtcaccgaagccatcggcatcatcgac
ttcggcgacgtgcaaattggcgatccggcctatgatttcgctgggctgtactgggattac
gggccagccttcgttcggaacgtgctcgatcactatgcggcttgcctaggcgcgtgggat
gtccacgcgttctgcactcgcgtcgaatatctcggcctccgggtcgggcttcgagaactc
cttcatgcggtggaacatcatcacacccgccgcatgcgcgagattcggaccaagcttcgc
gcctccctctcgccccggtga

DBGET integrated database retrieval system