KEGG   Acetobacter aceti: A0U92_05110Help
Entry
A0U92_05110       CDS       T04735                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aace  Acetobacter aceti
Pathway
aace00480  Glutathione metabolism
aace00590  Arachidonic acid metabolism
aace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aace00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A0U92_05110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A0U92_05110
Enzymes [BR:aace01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A0U92_05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AQS84255
UniProt: A0A1U9KEM5
Position
1126744..1127226
Genome map
AA seq 160 aa AA seqDB search
MSCAYDFSLPGLEGGVVDLGAWRGKPLLIVNTASKCGFTPQYEGLQSLWSEMDHELIVLG
VPSNDFGQQEPGSASEIATFCARNYGVSFPMTIRCHVKGTDATPLFRWLADKGGFFARPR
WNFFKYLINREGQLTNWFSSMTSPTSGRMHDAVNRVVLGS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgtgcctatgatttcagccttcccggtcttgagggaggcgtggtggatctcggg
gcctggcgtggaaagccgctgctcatcgtcaacacggcgtcgaaatgcggttttacgccg
caatatgaaggtttgcagtcgctctggtcggagatggatcacgaactcatcgttctgggt
gtgccgtccaatgatttcggccagcaggagccgggcagcgcctcggagatcgcgacattc
tgtgcgcgcaattacggcgtgagctttccgatgacgatcagatgtcacgtcaaggggacc
gatgccactcccctgtttcgctggctggctgataaaggtggatttttcgcgcgtccacgc
tggaatttcttcaaatatctcatcaacagggagggacagcttacaaactggttctccagt
atgacttcgcccacttcaggccgaatgcatgatgcggtaaaccgggttgttctgggaagt
taa

DBGET integrated database retrieval system