KEGG   Acetobacter aceti: A0U92_06975Help
Entry
A0U92_06975       CDS       T04735                                 

Definition
(GenBank) sirohydrochlorin ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
aace  Acetobacter aceti
Pathway
aace00860  Porphyrin and chlorophyll metabolism
aace01100  Metabolic pathways
aace01110  Biosynthesis of secondary metabolites
aace01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aace00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A0U92_06975
Enzymes [BR:aace01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     A0U92_06975
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     A0U92_06975
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     A0U92_06975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M TrkA_N PALP
Motif
Other DBs
NCBI-ProteinID: AQS84565
UniProt: A0A1U9KFI3
Position
complement(1564891..1566297)
Genome map
AA seq 468 aa AA seqDB search
MTANDLLAESRNIWFPVVLRLDNTTKALVIGGGEVAANKVSLLLATDTRIIVISPTLCDE
LQRALHAGRVEHIATEATRAVLETHLPGARLVYAATNDKAVNHLTAELAQALNIPVCAVD
DPDPSSFITPAIVRRGPVMVAISTSGAAPVLARRIRERIEAMLPAGISRLSRFMQNARRK
MAQIHPSPETRRRVWENFLDGRGMEQALAGDESGASTTLDRLASDEKGGGEVWLVGAGPG
DADLLTLKALRLMQNADSVLYDHLLPPDILDRVRRDAERIFVGKQKANHALPQPSINDEL
IRRAKAGERVLRLKGGDPFIFGRGGEEIEALMEAGVPFRVVPGISAANGCAASSGIPLTH
RDCAQSCLFLTGHARADGTLDLPWHTIALRGQTVVIYMGLGGIASLCEQLMTHGLPPTWP
AAVIEKGTQPDQRVITADLTSLPRLTIEQDFRSPALIIVGEVVKHRVA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaacgatcttctcgcagaatcaagaaatatctggtttccggtcgtgcttcgt
ctcgacaatacgacaaaggcgcttgtcattggaggtggtgaggtcgccgcaaacaaggtg
tctctcctgctggcgacagacacgcggatcattgtgatttctccgaccctgtgcgacgag
cttcaaagagcactgcacgccgggcgcgtggaacacatcgccacagaggccacccgcgcg
gtgctggaaacacacctgccgggcgcaagactggtttacgcggcgacaaacgacaaagcc
gtcaatcatctgaccgcggaactcgcacaggccctgaatattcccgtctgcgccgtggac
gaccccgatccgtcctccttcatcacccccgccatcgtgcgacgtggcccggtcatggtg
gcgatttccacctccggcgcagccccggtgctcgcgcggcgcatccgcgaacgcatcgaa
gccatgcttcccgcaggcatcagccgcctctcccgcttcatgcagaacgcccgcaggaag
atggcccagatccacccctcaccggaaacacgccgccgggtctgggagaatttcctggat
ggcaggggcatggaacaggctctggcaggggatgaaagcggcgcttccacaacccttgat
cgtctcgcatcggatgaaaaaggggggggtgaagtctggctggtcggcgcaggccccggt
gacgccgatcttctgacgctgaaagccctgcggctgatgcagaacgccgacagcgtgttg
tacgaccatctcttgccgccggacattctggaccgggtccgtcgcgatgcggaacggatt
ttcgtcggtaagcagaaagccaaccacgcactgccgcaaccttccatcaacgacgaactc
atccgccgcgcaaaggcaggcgagcgcgtgctgcgtctgaagggcggcgaccctttcatc
ttcgggcgtggtggcgaggagatcgaggcgctcatggaggcgggcgtgccattccgtgtc
gtgccgggcatttccgccgccaacgggtgcgccgcctcatccggaataccgctcacacat
cgggactgcgcgcagtcgtgcctgttcctgaccggacatgcccgtgcggacggcacactc
gatctgccgtggcacaccatcgcgctgcgtggccagacagtcgtgatctatatgggactc
ggcggcatcgcttctttgtgtgagcagttgatgacgcacggtctgccccctacatggcca
gccgccgtcattgaaaaaggcacgcaacccgatcagcgcgtgattaccgccgatctgaca
tccctgccccgccttacgatcgaacaggatttccgcagtccggcactgatcattgtcggt
gaggtggtgaaacaccgtgtggcgtga

DBGET integrated database retrieval system