KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_04380Help
Entry
ASQ49_04380       CDS       T04523                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Pathway
aaci00670  One carbon pool by folate
aaci01100  Metabolic pathways
aaci01120  Microbial metabolism in diverse environments
aaci01200  Carbon metabolism
Module
aaci_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:aaci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ASQ49_04380
Enzymes [BR:aaci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     ASQ49_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ALN14635
UniProt: A0A1P8TZR7
Position
complement(991617..993314)
Genome map
AA seq 565 aa AA seqDB search
MTVLSDLEIARVAHMEPIGEVAARAGIEPEFLEFYGNDVAKISLEAAEAHENRPRAKYVV
VTAITPTPLGEGKTTTAVGIAQGLEKIGRHSMLALRQPSMGPTFGIKGGAAGAGYSQVLP
MEKLNLHLTGDFHSITAAHNLLAAMIDNHLHQGNELDIEPHSISWRRVVDINDRALRNVI
VGLGSRIDGVPRETGFDITSASEVGVILSLATSLKDLRSRLGRIVIGYNRAKQPVTAEDL
HAAGSMTVILRDALKPNLLQTTENTPVLVHTGPFGNIATGNSSVVADQIGITSADYLLTE
AGFGSDMGAERFFNVKCRVSGLHPDAAVMVVTIRALKTHSGRYKVVPGKPLPEGMTLDNP
DDVWAGAPNLRKHIEIVRNFGVTPVVALNLFPGDHDDEIDVVRQIAEECGAHFAASSHVV
DGGDGATDLARAVVAACEEPTRFRYTYHLESPLAAKIEAVATRVYGADGIDVAPAAAKEL
AHFEELGYGHFPVVMAKTHLSLSHDPALKGAPTGWRLPVREVRAAVGAGYVYAICGDMRT
MPGLGKHPAAERIDIDENGETVGLF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgctgtcagaccttgagatcgcccgcgtcgctcacatggaacccatcggggag
gtggcggcacgggcggggatagaaccggagttcctcgagttctacggcaacgacgtcgcc
aagatctcgctggaggccgccgaggctcacgagaaccgccctcgcgccaagtacgtcgtc
gtcaccgcgatcacgcccactccgctcggggagggcaagaccaccacggcggtcggtatc
gcacagggtctggagaagatcggcaggcactccatgctggcccttcgtcagccctccatg
ggccccaccttcggcatcaagggcggcgcggccggcgccggatactcccaggtgctgccc
atggagaagctcaacctgcacctcaccggcgacttccactccatcaccgccgcccacaac
ctcctggccgcgatgatcgacaaccacctccaccagggcaacgagctcgacatcgaaccc
cactccatctcctggcgccgggtcgtggacatcaacgatcgcgccctgcgcaacgtcatc
gtcggcctgggcagccgcatcgacggcgtcccccgcgagacggggttcgacatcacctcc
gccagcgaggtcggcgtcatcctctctctggccacctcgctgaaggacctgcgctcccgg
ctgggccgcatcgtcatcggctacaaccgcgccaagcagcccgtcaccgccgaggacctt
cacgccgccggctcgatgaccgtcatcctgcgcgacgccctgaagcccaacctgctgcag
accaccgagaacacgcccgtcctggtgcacaccggccccttcggcaatatcgccaccggc
aactcctcggtggtcgccgaccagatcggcatcaccagcgccgactacctgctgaccgag
gccggcttcggctccgacatgggcgccgaacggttcttcaacgtcaaatgccgggtctcc
gggctccaccccgacgccgccgtgatggtggtcacaatccgcgcgctcaaaacccattcg
ggccgctacaaggtggttcccggcaagccgctgcccgagggcatgaccctcgacaatccc
gacgacgtctgggccggcgcgccgaacctgcgcaagcacatcgagatcgtccgcaatttc
ggggtgacgccggtggtcgccctcaacctgttcccgggcgaccacgacgacgagatcgac
gtcgtccgccagatcgcagaggagtgcggagcccacttcgcggcctccagccatgtggtc
gacggcggcgacggggccaccgatctggcccgggccgtcgtcgccgcctgcgaggagccc
accaggttccgctacacctaccacctcgaatcgcccctggcggccaagatcgaggccgtc
gccacccgcgtctacggcgccgacggcatcgacgtcgcgccggccgccgccaaggagctc
gcccacttcgaggagctcggctacggccacttcccggtggtgatggccaagacccacctg
tcgctgtcccacgaccctgcgctcaagggcgccccgaccggctggcgccttccggtccgc
gaggtgcgggccgcggtgggcgccggatatgtctacgcgatctgcggggacatgcgcacg
atgcccgggctggggaagcacccggccgccgagaggatcgacatcgacgagaacggggag
acggtcggcctgttctag

DBGET integrated database retrieval system