KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_0143Help
Entry
AANUM_0143        CDS       T04531                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00071  Fatty acid degradation
aacn00280  Valine, leucine and isoleucine degradation
aacn00310  Lysine degradation
aacn00380  Tryptophan metabolism
aacn00620  Pyruvate metabolism
aacn00630  Glyoxylate and dicarboxylate metabolism
aacn00640  Propanoate metabolism
aacn00650  Butanoate metabolism
aacn00900  Terpenoid backbone biosynthesis
aacn01100  Metabolic pathways
aacn01110  Biosynthesis of secondary metabolites
aacn01120  Microbial metabolism in diverse environments
aacn01130  Biosynthesis of antibiotics
aacn01200  Carbon metabolism
aacn01212  Fatty acid metabolism
aacn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aacn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AANUM_0143 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AANUM_0143 (atoB)
   00640 Propanoate metabolism
    AANUM_0143 (atoB)
   00650 Butanoate metabolism
    AANUM_0143 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    AANUM_0143 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AANUM_0143 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AANUM_0143 (atoB)
   00310 Lysine degradation
    AANUM_0143 (atoB)
   00380 Tryptophan metabolism
    AANUM_0143 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AANUM_0143 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AANUM_0143 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AANUM_0143 (atoB)
Enzymes [BR:aacn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AANUM_0143 (atoB)
Exosome [BR:aacn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AANUM_0143 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAS47374
Position
134440..135621
Genome map
AA seq 393 aa AA seqDB search
MENIVIVSAVRTPIGSFNGSLAAVSAVDLGATVIKEVINRADIDSALVNEVIMGNVLQAG
IGQNPARQAALKAGVAKGIPSYTVNKVCGSGLKSVALGAQAIASGDADIVAAGGMESMSQ
APYILDHKIRSGVRMGNLPLRDSMIEDGLTCAINHYHMGITAENIAEQYGISREEQDQLA
LRSQTLASQAVQNGVFDKEIVSVTVKTRKGDIAVSRDEYPKPDTTAEGLAKLRPAFKKDG
TVTAGNASGINDGAAALLLMSESKANALGLKPLARIRGYASAGVDPAVMGLGPVPATQKA
LRKAGLTLDDIDLIEANEAFASQFLGVGRELHFNMEKTNIHGGAISLGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGEGISVIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatcgttatcgtcagcgcggtcagaacgccgatcggcagctttaacggcagt
cttgccgccgtcagtgcggttgatctgggcgctaccgtgatcaaagaagtgatcaaccgc
gcagacatcgacagcgccttggtcaacgaagtgattatgggtaatgtgctgcaagccggt
atcggacaaaaccctgcccgtcaagctgcactcaaagcgggcgtggcgaagggaattccg
tcctacactgtcaataaagtctgcggttcgggcttaaaaagcgtggcgttgggcgcgcaa
gccattgccagcggcgacgccgacatcgtggcggccggcggcatggaaagtatgagccaa
gcgccgtacattctggatcataaaatccgttccggcgtcagaatgggcaatctgccgttg
cgcgacagcatgatcgaagacggtctgacgtgcgccataaaccattaccacatgggcatt
acggcggaaaatatcgccgaacaatacggtatcagccgtgaggaacaggatcagcttgcg
ctgcgttcgcaaacccttgcctctcaagcggtgcaaaacggcgtattcgacaaagaaatc
gtatctgtcaccgtgaaaacccgcaaaggcgacatcgctgtctcccgcgacgaatacccg
aaacccgacaccacagcggaagggctggcgaagttaagaccggcattcaaaaaagacggt
accgtcaccgccggtaacgcctccggtattaacgacggcgccgccgcgttattgttaatg
agcgaaagcaaagcgaacgcattaggactgaaaccgctcgcccgtatccgcggttacgcc
agtgcaggagtcgatcctgccgtgatgggattggggccggtgccggcaacccagaaagcg
ctgcgcaaagcgggattgacgctcgacgatattgacctgatcgaagcgaacgaagccttc
gcctcgcaattcctcggcgtcggcagagaactgcatttcaatatggagaaaaccaatatc
cacggtggtgccatctcgctgggtcaccctatcggcgccagcggcgccagaattctggtg
acgctgctgcacaatctcattgagaaagacaaaaagctcggtctggcgaccctgtgtatc
ggcggcggggaaggcatttcagtgattgtcgaacggatctga

DBGET integrated database retrieval system