KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_0328Help
Entry
AANUM_0328        CDS       T04531                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00564  Glycerophospholipid metabolism
aacn01100  Metabolic pathways
aacn01110  Biosynthesis of secondary metabolites
Module
aacn_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AANUM_0328 (psd)
Enzymes [BR:aacn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AANUM_0328 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Radial_spoke_3
Motif
Other DBs
NCBI-ProteinID: BAS47559
Position
complement(319081..319950)
Genome map
AA seq 289 aa AA seqDB search
MNKSTYWQRLKVAFQYVMPQLYLTQLAGWFAKQKWGAVTHFVIKLFAKKYNVDMSEAKKE
NFSDYESFNQFFIRELKDGARKINENPTALCLPADGRVSQIGHIDDELLLQAKGHFFSLS
DLLAGDEELVNTFKNGEFATIYLSPRDYHRVHMPCDATLRKMIYVPGALFSVNPFLAEHV
PNLFARNERVICLFDTEFGPMVQILVGATITASMSTVWAGVINPPRADEVKVWTYQEENA
VKLTKGQEMGAFQLGSTIINLFPANRVTLAEHLQVDEPVRVGEMLATIN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatccacttattggcagcgcctgaaagttgcctttcaatatgttatgccgcaa
ctgtatttaacccaactggcgggctggttcgccaagcaaaaatggggcgcggtcactcat
ttcgtaattaaactcttcgccaagaaatacaatgtggacatgagcgaagcgaaaaaagaa
aacttcagcgactacgaaagtttcaaccaattttttattcgcgaattaaaagacggtgcc
cgaaaaataaatgaaaatcctaccgcactttgcttgccggcagatggtcgtgtgagccaa
atcgggcatattgacgacgaattattattgcaagccaaagggcattttttcagcttgtcc
gatttattggcgggcgatgaagaattggtcaacacctttaaaaacggcgaattcgccacc
atctatttatctcctcgcgattaccaccgcgtgcatatgccgtgcgatgccaccctgcgc
aaaatgatttatgtgcccggcgccttgttctcggtgaatccgttcctggcggaacacgtg
cctaacttatttgcccgtaatgaacgggttatttgcctgtttgataccgaatttggccct
atggtgcaaattctggtgggtgccacgatcaccgccagcatgagcaccgtttgggcgggc
gtgattaatccgccgcgcgccgatgaagtgaaagtctggacgtatcaagaggaaaacgcg
gtaaaattgaccaaaggtcaggaaatgggcgcgtttcagttaggttctacgatcatcaac
cttttccctgctaatcgcgtgaccttagcagaacatttgcaggtggacgagcccgtcaga
gtgggtgaaatgttagccacgatcaattaa

DBGET integrated database retrieval system