KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_0555Help
Entry
AANUM_0555        CDS       T04531                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00030  Pentose phosphate pathway
aacn00480  Glutathione metabolism
aacn01100  Metabolic pathways
aacn01110  Biosynthesis of secondary metabolites
aacn01120  Microbial metabolism in diverse environments
aacn01130  Biosynthesis of antibiotics
aacn01200  Carbon metabolism
Module
aacn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aacn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AANUM_0555 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AANUM_0555 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aacn04147]
    AANUM_0555 (zwf)
Enzymes [BR:aacn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AANUM_0555 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AANUM_0555 (zwf)
Exosome [BR:aacn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AANUM_0555 (zwf)
  Exosomal proteins of colorectal cancer cells
   AANUM_0555 (zwf)
  Exosomal proteins of bladder cancer cells
   AANUM_0555 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAS47786
Position
529152..530711
Genome map
AA seq 519 aa AA seqDB search
MILPIIRSSYLNNDINMVTNQHGNKMKAENCCIVIFGASGDLTYRKLIPALYNLYKIDRL
GEDFSVLGVARTELNDKSFREKMRQTLIKNEGAKGECLEQFCGHLYYQAVNTADKADYAK
LVPRLDELHDTYRTEGNTLYYLSTPPSLYGVIPECLGEHGLNKEDRGWKRLIVEKPFGYD
RETAEALDIQIHRFFEEHQIYRIDHYLGKETVQNLLVLRFSNGWFEPLWNRNFIDYIEIT
GAESIGVEERGGYYDGSGAMRDMFQNHLLQVLAMVAMEPPAIINANSMRDEVAKVLHCLR
PLTQEDVEHNLVLGQYVAGEVDGEWVKGYLEEKGVPPYSTTETYMALRCEIENWRWAGVP
FYVRTGKRLPARVTEIVIHFKTTPHPVFSQNAPENKLIIRIQPDEGISMRFGLKKPGAGF
EAKEVSMDFRYADLAGATVMTAYERLLLDAMKGDATLFARTDAVHAAWKFVQPILNYKAQ
GGRLYDYEAGTWGPTAADKLIAKSGRVWRRPSGLMKKKV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgattttacctattatacgaagcagttatttaaacaatgacatcaacatggtaacaaat
caacatggtaacaaaatgaaagcagaaaactgttgtattgtaattttcggcgcctccggc
gatctcacttatcgtaaacttattccggctttatataacctctataaaattgatcgactg
ggtgaagatttctccgttctcggcgtggcacgtaccgaattgaatgacaaatcattccgt
gagaaaatgcgccaaacgctgatcaaaaatgaaggcgcgaaaggcgagtgcttggagcaa
ttttgcggccacctgtattatcaggcggtcaatacggcggacaaagcggattacgccaaa
ctggttccgcgtcttgacgaactgcacgacacctatcgcactgaaggcaacaccttgtat
tatctttccacgccgccgagcctatatggcgtgattccggaatgtttgggcgaacatggc
ttaaataaagaagatcgcggctggaagcgtcttattgtggaaaaaccgttcggttatgac
cgtgaaaccgccgaagcgctggatattcaaattcaccgtttctttgaagaacatcaaatt
taccgtatcgaccattatcttggtaaagaaaccgtccaaaacctgcttgtgttgcgcttt
tccaacggttggtttgagccgttgtggaaccgtaatttcattgattacattgaaatcacc
ggcgcggaatctatcggtgtagaagagcgtggcggctattatgacggttccggcgccatg
cgcgatatgttccaaaaccatttattacaagtgctggcaatggtggcgatggagccgccg
gcgattatcaacgccaattccatgcgtgatgaagtggcaaaagtgctgcattgtttgcgc
ccgttgacccaggaagacgtggagcataatctggtgttgggacaatatgtcgcaggcgaa
gtggacggcgaatgggtgaaaggctatttagaggaaaaaggcgtgccgccgtattccacc
actgaaacctacatggcgttgcgttgtgaaatcgaaaactggcgttgggcaggtgtgcct
ttctatgtgcgtaccggtaaacgcctgccggcgcgcgtcacggaaatcgtgattcatttc
aaaaccaccccgcacccggtattcagccaaaatgcgccggaaaataaattgattatccgt
attcaaccggacgaaggcatttctatgcgtttcggcttgaaaaaaccgggtgcaggcttt
gaagccaaagaagtgtcgatggatttccgctatgccgatcttgcgggtgccaccgtcatg
accgcttatgagcgtttattgcttgatgccatgaaaggcgacgcgaccctatttgcgcgt
accgatgccgtacacgccgcctggaaattcgttcaaccgattctgaactataaagcccaa
ggcggcagactttatgattacgaagccggcacctggggaccgacggcagccgataaactc
atcgccaaaagcggtcgtgtatggcgccgcccaagcgggttgatgaagaaaaaagtgtaa

DBGET integrated database retrieval system