KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_1308Help
Entry
AANUM_1308        CDS       T04531                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00051  Fructose and mannose metabolism
aacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AANUM_1308 (mtlD)
Enzymes [BR:aacn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AANUM_1308 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP DUF4073
Motif
Other DBs
NCBI-ProteinID: BAS48539
Position
1270263..1271411
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADSGVEVIFADVNDKVIDLLKTQQSYHVKIVGDSVNTVEE
VTNVTGINFKDENAVIELFKTVDLVTTAVGPNVLKIIAGTIAKGLVARFAAGNNTPLNII
ACENMVRGTTFLKEQVFAHLTPEQKAKAEELVGFVDSAVDRIVPPVQADESDPLLVTVEE
FSEWIVDETQFKGQIPAIRGMEKTDNLMAFVERKLFTLNTGHATTSYLGKLKGYRFVKES
IEDEAIKADVKATMQESGAVLIKRYGFAPQAHAAYIEKILKRFANPFLVDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYGLPNQHLVNAIAAALAYRNEQDPQALELAESLAENGVAETV
RKYAELQDDAVIERIVEAYQAI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacatttcggtgcgggcaatatcggtcgcggatttatcgggaaattgttg
gcggacagcggtgttgaagtgatttttgccgatgtgaatgataaggtgattgacctgctg
aaaacgcaacagtcctatcatgtcaaaatcgtcggcgacagtgtgaatacggtggaagaa
gtcactaacgttaccggtattaattttaaagatgaaaatgccgtgattgagttattcaaa
acggtggatttagtcaccaccgccgtaggaccgaatgtgctgaaaattatcgccggcaca
attgcaaaaggcttggtagcccgttttgccgccggtaacaacacgccgttaaatattatc
gcttgcgaaaatatggtgcgcggcacaactttcttaaaagagcaggttttcgcccactta
acgccggaacaaaaagccaaagcggaagaattggtcggtttcgtggattctgccgtggat
cgtatcgtgccgccggtgcaagcggatgaaagcgatcctttattggttaccgtggaagaa
ttcagcgaatggatcgtagatgaaactcagtttaaagggcaaatcccggcaattcgcggc
atggaaaaaaccgataatctgatggcatttgtggaacgcaaattgttcaccctgaacacc
ggacacgccaccacgtcttacttaggcaagctaaaaggctatcgcttcgtaaaagaaagc
attgaagacgaagccattaaagcggacgtgaaagctaccatgcaggaaagcggcgcggtg
ctgattaaacgttacggttttgctccgcaggcgcacgcggcgtatattgaaaaaatctta
aaacgctttgcgaacccgttcctggtggatgacgtggatcgtgtggggcgcgagcctttg
cgcaaattaagctataacgaccgcttaatcaaaccgttgcgcggcacattggaatacggc
ttgccgaatcagcatttggtcaatgccattgccgctgccttagcgtatcgcaacgaacag
gatccgcaagccttggaattggcggaatcgcttgccgaaaacggcgtcgcagaaaccgtg
cgtaaatatgccgagttgcaggacgatgccgtgattgaacgtatcgtagaggcttatcag
gcgatttaa

DBGET integrated database retrieval system