KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_2281Help
Entry
AANUM_2281        CDS       T04531                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00010  Glycolysis / Gluconeogenesis
aacn00030  Pentose phosphate pathway
aacn00051  Fructose and mannose metabolism
aacn00680  Methane metabolism
aacn01100  Metabolic pathways
aacn01110  Biosynthesis of secondary metabolites
aacn01120  Microbial metabolism in diverse environments
aacn01130  Biosynthesis of antibiotics
aacn01200  Carbon metabolism
Module
aacn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AANUM_2281 (fbp)
   00030 Pentose phosphate pathway
    AANUM_2281 (fbp)
   00051 Fructose and mannose metabolism
    AANUM_2281 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    AANUM_2281 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aacn04147]
    AANUM_2281 (fbp)
Enzymes [BR:aacn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AANUM_2281 (fbp)
Exosome [BR:aacn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AANUM_2281 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: BAS49512
Position
complement(2299929..2300600)
Genome map
AA seq 223 aa AA seqDB search
MKTLGQFIVEKQAEYPHAKGELSGILSSIRLVAKVVHRDINKAGLTNDIIGNSGVQNVQG
EAQMKLDLFAHNTMKQALMSREEVAGFASEEEENFIAFDTERGRNAKYVILTDPLDGSSN
IDVNVAVGTIFSIYRRVSPVGTPVTLEDFMQPGNRQVAAGYIVYGSSTMLVYTTGHGVNG
FTYDPSLGVFCLSHENIQIPQTGKIYSINEGQYLKFPMGVKNT
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaggtcaatttatcgtagaaaaacaagcggaatatccacatgctaaagga
gaattgagcgggattttatcttctattcgcctcgtggcaaaagtggttcatcgtgacatt
aataaagcggggttaaccaatgacattatcggtaattccggcgtgcaaaacgtgcagggt
gaagcgcaaatgaaattggatttatttgcccataatacgatgaaacaggccctaatgagc
cgtgaggaagtggcaggctttgcgtctgaagaagaggaaaatttcattgcttttgatacg
gagcgcggtcgtaacgcgaaatatgttattctaacggatccattggatggttcttctaac
attgatgttaatgtggcggtcggcacgattttttctatttatcgccgtgtatcgcccgtc
ggtacaccggttaccctcgaagatttcatgcagccgggcaatcgccaagtggcggcgggt
tatatcgtgtatggttcctccactatgttggtttataccaccgggcacggcgtaaatggt
tttacctacgatccgtccctcggcgtattctgtctttcccacgaaaatatccaaattccg
caaaccggcaaaatttattccattaatgaagggcaatacctcaaattcccgatgggcgta
aaaaatacctga

DBGET integrated database retrieval system