KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_00935Help
Entry
ACT75_00935       CDS       T04753                                 

Definition
(GenBank) rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Brite
KEGG Orthology (KO) [BR:aact00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aact03009]
    ACT75_00935
Enzymes [BR:aact01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ACT75_00935
Ribosome biogenesis [BR:aact03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ACT75_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN SelB-wing_3
Motif
Other DBs
NCBI-ProteinID: AMQ93193
UniProt: A0A142FXR3
Position
203247..204335
Genome map
AA seq 362 aa AA seqDB search
MNKLALYCRMGFERELAAEITDKAAENGVFGFARMAENSGYVIFECYQPGDADLLARELP
FQQLIFARQMLVVSDLLTDLPQQDRITPIVHQYQQIADTIALKNSSELWVETADTNEAKE
LLGFCRKFTVPLRQALKKQGWLNAKHNQKCGLTLHLFFLRNNACYVGYSYNHNHSAHLMG
IQRLKFPAEAPSRSTLKLEEAILTFISRHKEPELLNETMYAVDLGACPGGWTYQLVKRGL
FVYAVDHGKMAASLHETGRIEHCAEDGFKFQPPKRRKIDWLVCDMVEQPSRIAELMTKWL
LNGWCHSMIFNLKLPMKKRYAQVQQCLQLIADKLSQQGLKFQLQAKHLYHDREEITVYLR
LL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttggcattatattgtcgaatgggctttgagcgcgagctggcggcagaaatc
accgataaagcagcggaaaatggcgtgtttggatttgcccgcatggcggaaaacagcggc
tatgtgatatttgaatgctatcagcccggcgatgccgatttattggcgcgtgagttgcct
tttcaacagctgattttcgcccgtcaaatgttggtggtgtccgatttattaacggattta
ccgcaacaggatcgcatcacgccgattgttcaccaatatcaacaaattgccgataccatt
gcgttgaaaaacagcagtgaattatgggtggaaaccgccgataccaacgaagcaaaggaa
ttactcggattttgtcgcaaatttaccgtgccgttgcgtcaagcgttgaaaaagcaaggc
tggctaaatgccaaacacaatcaaaagtgcggtctgacattacatctttttttcttacgc
aataacgcctgctatgtgggctattcctataatcacaaccattccgcgcatttgatgggc
attcagcgcttaaaatttcccgccgaggcgccaagtcgttctacgctgaaactggaagag
gcgattttaaccttcatttcgcgccacaaagaaccggaattgcttaatgagacgatgtat
gccgtggatctcggcgcttgcccgggtggctggacctatcaattggtgaagcgcggttta
tttgtgtatgcggtggatcacggcaaaatggcagcaagtctgcatgagacagggcgcatt
gaacattgtgcggaagacgggtttaaatttcagccgccgaagcgacgtaaaatcgattgg
ctggtgtgcgatatggtggagcaacctagccgaattgcggaactgatgaccaaatggctg
ctcaacggctggtgccacagcatgattttcaacctaaaactgccgatgaaaaaacgctat
gcccaagtgcaacagtgcttgcaattgattgcggataagttgtcgcaacaaggcttaaaa
ttccagttacaggcaaaacatttgtatcacgatcgtgaagaaattaccgtttatcttcga
ttgttgtaa

DBGET integrated database retrieval system