KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_04645Help
Entry
ACT75_04645       CDS       T04753                                 

Gene name
mogA
Definition
(GenBank) molybdenum cofactor biosynthesis protein MogA
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Pathway
aact00790  Folate biosynthesis
aact01100  Metabolic pathways
aact04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aact00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACT75_04645 (mogA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    ACT75_04645 (mogA)
Enzymes [BR:aact01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     ACT75_04645 (mogA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AMQ93859
UniProt: A0A142FZM9
Position
complement(967151..967732)
Genome map
AA seq 193 aa AA seqDB search
MTALLKIGLVSVSDRASQGIYPDQGIPELRNWLQQALADSFEVVERLIPDEQAEIERTLC
ELVDEQHCHLVLTTGGTGPAKRDVTPDATLAVADREMPGFGEQMRQVSLHFVPTAILSRQ
VGVIRKESLILNLPGQPKAIKETLEGVKDKQGNVLVKGIFSAVPYCLQLINGLYINTKPD
VIVSFRPQSACRD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacttttaaagattggtttagtgtccgtctccgatcgggcgtcacaagggatt
tatccggatcaaggcattcccgaattacgcaactggttacaacaggcattggcggattct
tttgaggtggtggagcgtctcattcccgatgaacaggcggaaatagaacgcactctgtgc
gaactggtggatgagcaacattgtcatttggtgctgaccaccggcggcacgggcccggca
aaacgcgacgtgaccccggatgccaccctcgccgtcgccgaccgcgaaatgcccggtttc
ggtgaacaaatgcgtcaggtcagcctgcattttgtgccgacggcgattctctcccgccaa
gtgggcgttatccgtaaagaaagcctaatcctgaatttgcccggacagccgaaagccatc
aaagaaacgctggaaggggtaaaagacaaacagggcaacgttctggtcaaagggattttc
agcgccgtgccatactgtctgcaacttatcaacggcttatacataaacaccaaacccgac
gtcattgtcagtttcagaccccaatctgcttgtcgtgattaa

DBGET integrated database retrieval system