KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_04955Help
Entry
ACT75_04955       CDS       T04753                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Pathway
aact00010  Glycolysis / Gluconeogenesis
aact00020  Citrate cycle (TCA cycle)
aact00620  Pyruvate metabolism
aact01100  Metabolic pathways
aact01110  Biosynthesis of secondary metabolites
aact01120  Microbial metabolism in diverse environments
aact01130  Biosynthesis of antibiotics
aact01200  Carbon metabolism
Module
aact_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACT75_04955
   00020 Citrate cycle (TCA cycle)
    ACT75_04955
   00620 Pyruvate metabolism
    ACT75_04955
Enzymes [BR:aact01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ACT75_04955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AMQ93918
UniProt: A0A142FZT8
Position
complement(1036751..1038367)
Genome map
AA seq 538 aa AA seqDB search
MTDVNNVVKELEAIGIHNVKEVVYNPSYEQLFEEETKLGLEGFEKGTITTTGAVAVDTGI
FTGRSPKDKYIVLDDTTKDTVWWTSDAAKNDNKPMTQETWASLKDIVTKELSGKRLFVID
GFCGASEKDRIAVRIVTEVAWQAHFVKNMFIRPTDAELKDFKPSFVVMNGSKCTNPNWKE
QGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLPLKGVGAMHCSANVGKDGD
VAVFFGLSGTGKTTLSTDPKRELIGDDEHGWDDVGIFNFEGGCYAKTIHLSEENEPDIYR
AIRRDALLENVVVRADGSVDFDDGSKTENTRVSYPIYHIDNIVKPVSRAGHATKVIFLTA
DAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPTQYA
EVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIEKAQMSELPIFNLAI
PKALPGVDPAILDPRDTYADKAQWEAKAKDLAGRFVKNFEKYATNAEGKALISAGPKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgtaaacaacgtagttaaagagcttgaggcaattggtattcataatgtaaaa
gaagtggtttataacccaagttatgaacaactttttgaagaagaaacaaaactaggcttg
gaaggtttcgaaaaaggcaccatcaccaccaccggcgcggtcgctgtggataccggcatt
tttaccggacgttctcctaaggataaatatattgttttagatgataccaccaaagacacc
gtatggtggacttccgacgcggcgaaaaacgacaataaaccgatgacccaagaaacctgg
gcaagtttaaaagacatcgtcaccaaagaactttccggcaaacgcttattcgtgattgac
ggcttctgcggtgccagcgaaaaagaccgtattgcggtgcgtatcgtgactgaagtggca
tggcaggcgcatttcgtgaaaaatatgtttattcgtccgacagacgccgaattaaaagat
ttcaaaccaagtttcgtggtgatgaacggttctaaatgcaccaacccgaactggaaagaa
caaggcttgaattccgaaaacttcgtagcgtttaacttaaccgaacgcattcaattaatc
ggcggcacctggtacggcggcgaaatgaagaaaggtatgttctctatgatgaactacttc
ctgccgctaaaaggcgtgggcgcaatgcactgttccgctaacgtaggcaaagacggtgat
gttgctgtgttcttcggcttgtccggtaccggtaaaaccaccctttctaccgatccgaaa
cgtgagctaatcggtgatgatgaacacggttgggatgatgtgggtatcttcaactttgag
ggtggttgttacgcgaaaaccattcacctttctgaagaaaacgaaccggatatttatcgc
gcaatccgtcgtgatgccttattggaaaacgtagtggtgcgggcagacggttcagtggat
ttcgatgacggttccaaaaccgaaaacacccgcgtttcctatccgatttatcacatcgat
aacatcgttaaaccggtttcccgcgcaggtcacgctactaaagtgattttcttaaccgct
gacgctttcggcgtgttgccgccggtatctaaattgacaccggaacaaaccaaatactac
ttcttatctggtttcactgcgaaattagccggtaccgaacgtggtattaccgaaccgact
ccaaccttctccgcctgtttcggtgcggcattcttaaccttacacccaacccaatatgcg
gaagtgttggtaaaacgtatgcaagcggcaggtgcggaagcctatttggtgaacaccggt
tggaacggcacaggcaaacgtatctccattaaagatacgcgcggtattatcgacgccatc
ttagacggttctatcgaaaaagcgcaaatgagcgagttaccaatcttcaatttggcaatt
cctaaggcattacccggcgttgatccggctattttagatccgcgtgatacttatgccgat
aaagcgcaatgggaagccaaagcgaaagatcttgccggtcgttttgtgaagaacttcgaa
aaatacgctaccaatgcagaaggcaaagccttaatttctgccggtcccaaagcgtaa

DBGET integrated database retrieval system