KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_09425Help
Entry
ACT75_09425       CDS       T04753                                 

Definition
(GenBank) aspartate--tRNA(Asp/Asn) ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Pathway
aact00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aact00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACT75_09425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aact01007]
    ACT75_09425
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aact03016]
    ACT75_09425
   03029 Mitochondrial biogenesis [BR:aact03029]
    ACT75_09425
Enzymes [BR:aact01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     ACT75_09425
Amino acid related enzymes [BR:aact01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   ACT75_09425
Transfer RNA biogenesis [BR:aact03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACT75_09425
 Prokaryotic Type
   Other AARSs
    ACT75_09425
Mitochondrial biogenesis [BR:aact03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ACT75_09425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: AMQ94717
UniProt: A0A142G237
Position
1924864..1926642
Genome map
AA seq 592 aa AA seqDB search
MMRSHYCGALNRTNIGQEITLSGWVHRRRDLGGLIFIDMRDREGIVQVCFDPKYQKALIA
AAGLRNEFCIQIQGEVIARPDNQINKNMATGEVEVLAKVLKIYNASDVLPLDFNQNNTEE
QRLKYRYLDLRRPEMAQHLKTRAKITGFVRRFMDDNGFLDIETPMLTKATPEGARDYLVP
SRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFL
TAPEVREIMERMVHGLWQHILGVDLGKFPVMTWQEAMRRFGSDKPDLRNLLEMVDVADIV
KNVDFKIFQGPANDPNGRVIVIRVPRGNEITRKQIDEYTQFVGIYGAKGLAWLKVNDVNA
GLEGVQSPIAKFLNEDVLKALFERVGAQTGDILFFGADKWQTATDSMGALRLKLGRDLGL
TRLDEWQPLWVIDFPMFERDDEGCLAAMHHPFTSPKDFTPEQLEADPTSAVANAYDMVIN
GYEVGGGSVRIFDPKMQQTVFRILGIDEEQQREKFGFLLDALKFGTPPHAGLAFGLDRLT
MLLTGTENIRDVIAFPKTTAAACLMTEAPSEANPQALSELSIQVVKSNKAEE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgttcacattattgcggtgcgttaaatcgtaccaatattggccaagagataacc
ttaagcggatgggttcatcgtcgccgtgatttaggcggtttaatttttattgatatgcgc
gatcgtgaaggcatcgtgcaagtgtgttttgatccgaaatatcaaaaagccttaatcgcc
gctgcgggtttgcgtaacgaattttgtattcaaattcaaggcgaagtcattgcccgtccg
gataatcaaatcaacaaaaatatggcgaccggtgaagtggaagtgttggcaaaagtgttg
aaaatttacaatgcttccgatgtgttaccgctcgatttcaaccaaaacaatactgaagaa
caacgcctaaaatatcgttatttggatttacgtcgccctgaaatggcgcagcatttgaaa
acccgcgcgaaaatcactggttttgtgcgccgctttatggacgacaacggtttcttggat
attgaaacgccgatgctcactaaagccaccccggaaggcgcgcgcgactatcttgtgcca
agccgtgtgcataaaggcaaattctacgcgcttccgcaatcgccgcagctttttaaacag
cttttgatgatgtccggttttgatcgttattatcaaatcgtgaaatgcttccgcgatgaa
gatttgcgcgcggatcgtcaacctgaattcacgcagattgatgtggaaacttcgttctta
accgcgccggaggtacgtgaaatcatggaacgtatggtgcacggtttgtggcagcatatt
ttaggtgtggatttgggtaaattcccggtgatgacctggcaagaagcgatgcgccgtttt
ggttccgataaaccggatttgcgtaatctgttagaaatggtggacgtggcagatattgtc
aaaaacgtagatttcaagatattccaaggtccggcaaatgatccgaatggtcgtgtcatc
gtaattcgtgtgccgcgggggaatgaaatcacccgtaaacaaattgatgaatatacccaa
tttgtcggcatttatggtgcgaaaggcttggcttggttaaaagtgaatgacgtaaacgcc
ggtcttgaaggtgtccaaagccctattgcaaaattcttaaatgaagacgtgctaaaagcc
ttgtttgaacgcgtgggcgcgcaaaccggcgatattttattcttcggcgccgacaaatgg
cagaccgccacagattcaatgggcgcgttacgtttgaaattaggacgcgatctcggttta
acccgtttagatgaatggcaaccgctttgggtgattgatttccccatgtttgaacgtgat
gatgaaggctgcttggcggcaatgcaccacccattcacctcgccaaaagatttcacacct
gaacaattagaagcggatccgacaagtgcggtcgccaatgcttacgatatggtcatcaat
ggctatgaagtgggtggcggttccgtgcgtatttttgatccgaaaatgcaacaaaccgtg
ttccgcattctcggtattgacgaagaacaacaacgcgaaaaattcggcttcttattagat
gcgttaaaattcggcacaccaccgcatgccggtcttgcgttcggtttagaccgtttgact
atgttattaaccggcacggaaaacattcgcgacgtgatcgccttcccgaaaaccactgca
gcggcgtgtttaatgacggaagcgccaagtgaggcgaatccgcaggcgttgtcggaatta
agcattcaagtggtaaagagcaataaagcggaggagtga

DBGET integrated database retrieval system