KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_09625Help
Entry
ACT75_09625       CDS       T04753                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Pathway
aact00051  Fructose and mannose metabolism
aact01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ACT75_09625
Enzymes [BR:aact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ACT75_09625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP DUF4073
Motif
Other DBs
NCBI-ProteinID: AMQ94753
UniProt: A0A142G273
Position
1963967..1965115
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADSGVEVIFADVNDKVIDLLKTQQSYHVKIVGDSVNTVEE
VTNVTGINFKDENAVIELFKTVDLVTTAVGPNVLKIIAGTIAKGLVARFAAGNNTPLNII
ACENMVRGTTFLKEQVFAHLTPEQKAKAEELVGFVDSAVDRIVPPVQADESDPLLVTVEE
FSEWIVDETQFKGQIPAIRGMEKTDNLMAFVERKLFTLNTGHATTSYLGKLKGYRFVKES
IEDEAIKADVKATMQESGAVLIKRYGFAPQAHAAYIEKILKRFANPFLVDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYGLPNQHLVNAIAAALAYRNEQDPQALELAESLAENGVAETV
RKYAELQDDAVIERIVEAYQAI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacatttcggtgcgggcaatatcggtcgcggatttatcgggaaattgttg
gcggacagcggtgttgaagtgatttttgccgatgtgaatgataaggtgattgacctgctg
aaaacgcaacagtcctatcatgtcaaaatcgtcggcgacagtgtgaatacggtggaagaa
gtcactaacgttaccggtattaattttaaagatgaaaatgccgtgattgagttattcaaa
acggtggatttagtcaccaccgccgtaggaccgaatgtgctgaaaattatcgccggcaca
attgcaaaaggcttggtagcccgttttgccgccggtaacaacacgccgttaaatattatc
gcttgcgaaaatatggtgcgcggcacaactttcttaaaagagcaggttttcgcccactta
acgccggaacaaaaagccaaagcggaagaattggtcggtttcgtggattctgccgtggat
cgtatcgtgccgccggtgcaagcggatgaaagcgatcctttattggttaccgtggaagaa
ttcagcgaatggatcgtagatgaaactcagtttaaagggcaaatcccggcaattcgcggc
atggaaaaaaccgataatctgatggcatttgtggaacgcaaattgttcaccctgaacacc
ggacacgccaccacgtcttacttaggcaagctaaaaggctatcgcttcgtaaaagaaagc
attgaagacgaagccattaaagcggacgtgaaagctaccatgcaggaaagcggcgcggtg
ctgattaaacgttacggttttgctccgcaggcgcacgcggcgtatattgaaaaaatctta
aaacgctttgcgaacccgttcctggtggatgacgtggatcgtgtggggcgcgagcctttg
cgcaaattaagctataacgaccgcttaatcaaaccgttgcgcggcacattggaatacggc
ttgccgaatcagcatttggtcaatgccattgccgctgccttagcgtatcgcaacgaacag
gatccgcaagccttggaattggcggaatcgcttgccgaaaacggcgtcgcagaaaccgtg
cgtaaatatgccgagttgcaggacgatgccgtgattgaacgtatcgtagaggcttatcag
gcgatttaa

DBGET integrated database retrieval system