KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_11415Help
Entry
ACT75_11415       CDS       T04753                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Pathway
aact00620  Pyruvate metabolism
aact01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACT75_11415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aact02000]
    ACT75_11415
Enzymes [BR:aact01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     ACT75_11415
Transporters [BR:aact02000]
 Other transporters
  Primary active transporters [TC:3]
   ACT75_11415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AMQ95078
UniProt: A0A142G348
Position
complement(2344658..2346454)
Genome map
AA seq 598 aa AA seqDB search
MTKKIKVTELVLRDAHQSLFATRLRLDDMLPIAHELDDIGYWSLEAWGGATFDSCIRFLG
EDPWVRLRELKKACPKTPLQMLLRGQNLLGYRHYADDVVERFVERCVANGMDVFRVFDAL
NDPCNMKAALQAVRKFGGHAQGTLSYTTSPVHTMQTWLDTTEQLLEIGIDSLVIKDMSGI
LNPMAAAELVREIKKRFDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTAISSMSATYGH
PATESIVATLQGTEYDTGLDIPRLEKIAAYFRNVRKKYAKFEGQLRGVDSRILVAQVPGG
MLTNLENQLKQQNASDKLDLVLEEIPRVRKDLGYIPLVTPTSQIVGTQSVINVLTGERYK
TIAKETAGILKGEYGKTPAPVDSALQARVLEGAAPMTDRPADHIAPEMAKIEAEVAEQAK
AKGVKLSENAVDDALIVALFPQIAWKFLENRNNPAAFEPVPTSKESAIENKPVSKAAPAA
SVPAVYTVELEGKAFVVKVSEGGDISHVATTTPQVAPQAAPAPAPTSGGTPVTAPMAGNI
WKVAATEGQTVAAGDVLFILEAMKMETEVKAAQGGTVRGIVVKAGDAVAVGDTVMTLV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattaaagtgaccgaactggtgcttcgtgatgcccaccaatcgcttttt
gcaacccgtttgcgtcttgatgacatgttgccgattgcccatgaactggacgacatcggt
tattggtcgctggaagcttggggcggtgcgacatttgacagctgtattcgttttttgggt
gaagatccgtgggtgcgtttgcgtgagttgaaaaaagcctgcccgaaaaccccgctacaa
atgctgttgcgcggtcaaaatctgctgggttatcgccactatgccgatgacgtggtggag
cgttttgtggaacgctgcgtggcgaacggtatggatgtgttccgtgtgttcgatgccctt
aatgacccgtgtaatatgaaagcggcgttgcaagcggtgcgtaaattcggcggccatgcg
caagggacgttaagttacaccaccagccccgttcacaccatgcaaacctggctcgacacc
accgaacaattgcttgaaatcgggatcgacagcctcgtgattaaagatatgtcgggcatt
ttgaatccgatggcggcggcagaactagtacgcgaaatcaaaaaacgtttcgacgtggaa
ttgcatttacactgccactccaccaccggcatggcggaaatggccctgttaaaagccatt
gaagcgggtgtggacggtgtggatacagcgatttcctccatgtccgccacctacggtcac
cctgctacagaatccatcgtggcgaccttgcaaggcactgaatacgacaccggcttggat
attccacgcctggaaaaaatcgcagcgtatttccgcaatgtacgtaaaaaatatgcaaaa
tttgaaggtcagcttcgcggcgtggacagccgaattttggtggcgcaagtgccgggcggt
atgctcaccaacctggaaaaccaattaaaacaacaaaacgcctccgacaaattggatctg
gtgttggaagaaattccgcgtgtacgcaaagatttgggttacattccgttggtgactccg
acatcacaaatcgtcggtacccaatccgtaattaatgtgctcacaggcgaacgctacaaa
actatcgccaaagaaaccgccggtatcttaaaaggcgaatacggcaaaacaccggcgccg
gtggatagcgcgctacaagcccgcgtattggaaggcgctgcgccgatgaccgaccgccct
gccgatcacattgcccctgaaatggcaaaaattgaagcggaagtcgccgaacaagccaaa
gcgaaaggggtgaaattatccgaaaatgccgtagatgatgccttaatcgtcgccctcttc
ccgcaaatcgcgtggaaattcctggaaaatcgcaacaaccctgccgcctttgaaccggtg
ccgacaagcaaggaaagtgcaatagaaaataaacctgtttcgaaagccgcaccggcggca
tcagtccctgccgtttataccgtggaattagaaggcaaagcctttgtggtgaaagtgagc
gaaggcggtgacatttcccatgtggcaaccaccacaccacaagtagcgccgcaagccgca
ccggcacctgcgccaaccagcggcggaacaccggtcactgcgccgatggcaggtaacatc
tggaaagtggcggcaacagaaggacaaaccgttgccgcaggtgatgtgttattcattctt
gaagccatgaaaatggaaaccgaagtaaaagcggcgcaaggcggcacagtgcgcggcatt
gtggtgaaagccggcgacgccgtggcggtgggtgataccgtaatgaccctcgtgtaa

DBGET integrated database retrieval system