KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0168Help
Entry
TC41_0168         CDS       T01821                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00450  Selenocompound metabolism
aad00970  Aminoacyl-tRNA biosynthesis
aad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TC41_0168 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TC41_0168 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aad01007]
    TC41_0168 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aad03016]
    TC41_0168 (metG)
Enzymes [BR:aad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TC41_0168 (metG)
Amino acid related enzymes [BR:aad01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TC41_0168 (metG)
Transfer RNA biogenesis [BR:aad03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TC41_0168 (metG)
 Prokaryotic type
   Other AARSs
    TC41_0168 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: AEJ42146
UniProt: F8IIZ5
Position
165429..167387
Genome map
AA seq 652 aa AA seqDB search
MCVKPTFYVTTPIYYPNDKLHIGHAYTTVAADAIARYKRLRGYDVFFLTGTDEHGLKIQQ
RAEQAGLEPKAFLDPIIAWIQDLWKKLDISYDDFIRTTEARHERVVEQIFERLLQQGDIY
LSEYQGWYCTPCESYWAERELVDGKCPQCGREVQFVREESYFFRMSKYVDRLLQYYEENP
GFIEPISRKTEMIKNFIEPGLQDLCVSRTSFDWGVHVPSNPKHVVYVWLDALVNYISAIG
YLSDDADERAKFERYWPADVHVVGKDIVRFHAVYWPIILMALGLPLPKKVFGHGFFLVKG
GKMSKSKGNVIDPLSLVDRYGRDAFRYFLLREIPFGQDGTFTPEGMVERLNYDLANDFGN
LVHRTAAMLNRFNDGVVPKPGSLTDVDRALRDLAAEVKAKVEENMDQLQFSVALAELWNL
VRAANKYIDDCQPWKLNKEGERERLATVLYHMVEAIRVSTILVQPFMTDAPKAIREQFGW
GDEAFAWDSAEMGVGPSGQKVAEREPLFPRLDVEKEIEILTEMTGSAQQASAESKLEEPS
NVVHKDEITIDVFDKVELRVGQVLACEKHPNADKLLVLQVDLGGETRQIVSGIAKYYKPE
ELVGKKVVVVANLKPVKLRGQDSLGMILCASEGDTLSIVTVPDTMPNGAIVK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtgaaaccgaccttctacgtcacaacgcccatttattacccgaacgacaagctt
cacatcggccacgcgtacaccaccgtggccgccgacgccatcgcgcgttacaagcgcctg
cggggctacgacgtgttcttcctcaccggcaccgatgaacacggcctcaagatccagcag
cgcgcggagcaggccgggctcgagccgaaggcgtttctggatcccatcatcgcctggatt
caggacctgtggaagaagctcgacatctcctacgacgatttcattcgaaccacggaggcc
cgtcacgagcgcgtggtcgagcagatcttcgagcgcctgcttcagcagggcgacatctac
ctctccgagtatcaggggtggtactgcacgccttgcgagtcgtactgggcggagcgcgaa
ctcgtggacggcaagtgtccgcagtgcgggcgcgaggtccagttcgtccgcgaagagtcg
tatttcttccgcatgagcaaatacgtggatcgcctgctgcaatactatgaggaaaacccg
ggcttcatcgagcccatctcgcgcaagacggagatgatcaagaatttcatcgagcctggg
ttgcaggatctctgcgtctcgcgcacctcgttcgactggggcgtgcacgtgccctccaat
ccgaagcacgtggtgtacgtgtggctcgacgcgctcgtcaactacatctcggccatcggc
tatctctcggacgacgcggatgagcgcgcgaagttcgagcgctactggcctgcggacgtc
cacgtcgtcggcaaggacatcgtccgcttccacgcggtctactggcccatcatcctcatg
gcccttggcctgcccctgccgaagaaggtgttcggccacggattcttcctcgtcaagggc
ggcaagatgtcgaagtcgaagggcaacgtgatcgatccgctctcgctcgtggatcggtac
gggcgggacgcgttccgctacttcctgctgcgcgagatcccgttcgggcaggacgggacg
ttcacgcccgagggcatggtcgagcggctcaattacgatctcgccaatgacttcggcaat
ctcgtccaccgcaccgccgccatgctgaaccggttcaacgacggcgtggtgcccaaaccg
ggatcgctcacggacgtcgatcgcgcccttcgcgatctcgccgccgaggtcaaggcgaag
gtcgaggagaacatggaccagctccagttctcggtggcgctcgcggagctttggaacctc
gtgcgcgcagccaacaagtacatcgacgactgccagccgtggaagctgaataaggagggc
gagcgggagcggctcgcgacagtgttgtaccatatggtcgaggccattcgcgtctccacc
atcctcgtgcagcccttcatgacggatgcgccgaaggccatccgcgagcaattcggctgg
ggagacgaggcgtttgcgtgggacagcgccgaaatgggcgtcggcccgagcgggcaaaag
gtggccgagcgggagcccctgttcccgagactcgatgtggaaaaggagattgagatcttg
acggagatgacaggttcagcccagcaggccagcgcggaatcgaagctcgaggagcccagc
aacgtggtgcacaaggacgagatcaccatcgacgtcttcgacaaagtggagctgcgcgtc
ggccaggtgctcgcctgcgagaagcacccgaacgccgacaaactgctcgtgcttcaggtc
gatctcggcggtgaaacgcgccaaatcgtgtccggcattgcgaagtattacaagcccgag
gagctcgtgggcaaaaaggtggtcgtcgtggccaacctgaagccggtcaaactgcgcggt
caggactcgctcggcatgatcctctgcgcgtccgagggagatacgctctccattgtgacg
gtgccggacaccatgccgaacggagcgattgtgaagtga

DBGET integrated database retrieval system