KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0241Help
Entry
TC41_0241         CDS       T01821                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00900  Terpenoid backbone biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
Module
aad_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TC41_0241 (ispE)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TC41_0241 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEJ42215
UniProt: F8IJM6
Position
225290..226168
Genome map
AA seq 292 aa AA seqDB search
MLLQRAYAKINLTLDVLGRRDDGYHEVDMVMQTVDLSDVVWLEARADGDITMESTSSSVP
MDERNLCVQAARAFKRRTGFPGGVHIQLEKHIPVAAGLAGGSSDAAAVLRGLNQLSGAGL
TLDELADIGAEVGSDVPYCVYGGLAIARGRGERVTRYPHVPAMYAVLLHPRLFVSTADVY
RGLEPSDFTSSPRSEEMVRCLAEGDHERVVALVHNALERVTLSLYPELRALKERVTSIAQ
RPVHMSGSGPTMFMLTPVHTHAQRLYNALRGIMKDVYVCRFVGGYAQAHARS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttgcaacgcgcgtacgcgaagatcaacctgaccctggatgtccttgggcgccgc
gacgacggctatcacgaggtcgacatggtcatgcagacggtggacctgtcggatgtcgtc
tggcttgaggctcgagccgacggcgacatcaccatggagagcacatcgtcctcggtgcct
atggacgagcggaacctgtgcgtgcaggcagcgcgggcattcaagcgccgcacgggcttt
ccgggcggcgtgcacattcagctcgaaaaacacattcctgtcgccgcggggctcgccggc
gggtcgagcgacgccgcggctgttttgcgcgggctgaatcagttatcaggcgcggggctc
accctggacgaactcgcggacatcggcgcggaagtgggatccgacgtcccctactgcgtc
tatggcgggctcgccatcgcgcgcgggcggggcgaacgcgtgacgcgctatccgcacgtc
ccggccatgtatgcggtgctgttgcacccgcgcctcttcgtctcaactgcggacgtctac
cgcggccttgagccttccgatttcacctcctccccgcgcagcgaggagatggtgcgctgc
ctcgcggaaggggaccacgagcgggtggttgcgctcgtccacaacgccctggagcgcgtc
accctgagcctttatccggagctacgggcgctcaaggagcgggtgacctccatcgcgcag
cggcctgtgcacatgtcagggtcggggcccacgatgttcatgctgacccccgtgcatacg
cacgcgcagcggctgtacaacgcgctccgcggcatcatgaaagacgtgtacgtgtgccgg
tttgtgggcggctacgcccaagcacacgcgcgcagctga

DBGET integrated database retrieval system