KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1177Help
Entry
TC41_1177         CDS       T01821                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00010  Glycolysis / Gluconeogenesis
aad00620  Pyruvate metabolism
aad00640  Propanoate metabolism
aad00680  Methane metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_1177
   00620 Pyruvate metabolism
    TC41_1177
   00640 Propanoate metabolism
    TC41_1177
  Energy metabolism
   00680 Methane metabolism
    TC41_1177
Enzymes [BR:aad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TC41_1177
Lipid biosynthesis proteins [BR:aad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TC41_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEJ43120
UniProt: F8IGV5
Position
complement(1167891..1169945)
Genome map
AA seq 684 aa AA seqDB search
MTPVGDCLFEQLILSWNRTIQAAAVIGAARERSQSMTPNDLDALLRETRTFAPPEEFRRQ
ANYHDESIYEEAARDPEGYWAKQAEHITWFHEFESVCRWDPPHAQWFIGGKLNAAYNCVD
RHTLTHRKNKAAIIWEGEPGDSRVLTYDMLRHEVDKAAHMLSQLGVKKGDRVTIYLPMVP
ELPIAMLACAKIGAMHSVVFGGFSAQSLKDRILDAGSKVLITADGGWRRGKVIPLKQNAD
EAVEGTPIEKVVVVKRIGDAAQASMNPTRDIWWHEAMENAPTKPFPAEPMDAEDYLFLLY
TSGTTGKPKGIVHSTGGYLVGVNTSMRTVFDLKDDDVFFCTADIGWITGHTYIVYGPLSA
GATVVMYEGSPDYPDRDRYWAIVEKYGATILYTAPTSIRMFMKWGPQYVEKHDLSTLRLL
GSVGEPINPEAWMWYHKYVGQERCPIVDTWWQTETGCAMIAPLPGIITTKPGSATKPVPG
ISVDILDDDGNPVPAGHGGNLVITKPWPSMLRTVWGDDERFRKTYFGKFEGIYLPGDGAY
RDQDGYYWIVGRLDDVINVSGHRIGTAEVESALVAHPAVAEAAVIGRAHEVKGQAITAFV
ILKEGHTGSDDLVAELKQFVVEQIGAMARPEEIIFTADLPKTRSGKIMRRLLRDIAEGRV
VGDTTTLADPAVVEQLKSQYKDQE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
ttgacgccggttggagattgtcttttcgagcaacttattctatcatggaatcgaaccatt
caagctgccgccgtgatcggcgcggccagagaaaggagccagagtatgaccccaaatgat
ctcgacgcactactccgtgaaacgcgcacctttgccccgcctgaagaatttcgccgccaa
gcgaattaccatgatgaaagcatttacgaggaagccgctcgtgatccggaaggttactgg
gcgaaacaagccgaacatatcacttggttccatgaatttgaaagcgtttgcaggtgggac
ccgccgcacgcacaatggttcatcggcggcaagttgaacgccgcgtataactgcgtggat
cgtcacaccctcacgcaccgcaaaaataaggcggctatcatctgggaaggtgaacctggc
gacagccgcgtcctcacgtacgacatgctgcgccatgaagtggataaggccgcgcacatg
ctcagccagctcggggtcaaaaagggagaccgcgtcaccatctacctgcccatggtgccc
gagcttcccattgcgatgctcgcgtgcgccaagatcggtgccatgcattccgtcgtgttt
ggaggcttttccgcccaatccttaaaagatcgcatcctggacgcagggagtaaagtgctc
atcacggcggatggcggctggcgccgaggcaaggtcattccgctcaagcaaaacgccgac
gaagccgtcgaaggaacccccattgagaaagtggtggttgtcaaacggattggcgacgcg
gcgcaagcgagcatgaatccgacccgggacatctggtggcatgaagccatggagaacgcg
ccgaccaagccgttcccggctgagcccatggacgcggaagactacctctttctgctctac
acgtcaggcacgacgggcaagccgaagggcatcgtccacagcacaggcggatacctggtg
ggcgtcaatacgtccatgcgaacggtgttcgatctcaaggacgacgacgtgttcttctgc
acggccgacatcggttggattaccggccacacctacatcgtgtacggcccgctgtcggcc
ggcgcgacggtggtcatgtacgagggatcgcccgattatcccgatcgcgaccggtactgg
gccatcgtggagaagtacggcgcgaccatcctgtacaccgcgccgacatccatccgcatg
ttcatgaagtggggtccccagtacgtcgaaaagcacgatctcagcacgctgcggctgctc
ggttccgtcggcgagcccatcaatccagaggcgtggatgtggtaccacaaatatgttggg
caggagcggtgccccatcgtggacacctggtggcagacggagaccggctgtgcgatgatc
gcgcctctacccggtatcatcaccaccaagcctggctccgccaccaagcctgtgcctggc
atctccgtggacattctcgacgacgacgggaatccggtgccagctggtcatggcggaaat
ctcgtcatcaccaagccgtggccgtcgatgctgcgcaccgtctggggtgacgacgagcgc
ttccggaagacgtacttcgggaagttcgaaggtatctacctgcccggagacggcgcatat
cgagatcaggatggctactactggattgtcggacggttggacgacgtcatcaatgtctcg
ggtcaccgcatcggcactgcggaagtcgagagcgccctcgtggcacatcctgccgtggca
gaggcagccgtgatcggacgcgcccacgaagtcaaggggcaggccatcactgcgttcgtc
atcctcaaggagggtcataccggttcggacgatctcgtcgcggagctgaagcagttcgtc
gtggagcaaatcggcgccatggcgcggcccgaggaaatcatcttcaccgcagatctaccg
aagacgcgcagcggcaagatcatgcgacgcttgttgcgcgacatcgcggagggacgcgtg
gtcggcgacaccaccacccttgccgatccggccgtggtggagcaactgaaatcacagtac
aaggatcaggaatga

DBGET integrated database retrieval system