KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1515Help
Entry
TC41_1515         CDS       T01821                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00360  Phenylalanine metabolism
aad00362  Benzoate degradation
aad00621  Dioxin degradation
aad00622  Xylene degradation
aad01100  Metabolic pathways
aad01120  Microbial metabolism in diverse environments
aad01220  Degradation of aromatic compounds
Module
aad_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    TC41_1515 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TC41_1515 (mhpE)
   00622 Xylene degradation
    TC41_1515 (mhpE)
   00621 Dioxin degradation
    TC41_1515 (mhpE)
Enzymes [BR:aad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     TC41_1515 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm AbfS_sensor
Motif
Other DBs
NCBI-ProteinID: AEJ43447
UniProt: F8IJC7
Position
complement(1490385..1491443)
Genome map
AA seq 352 aa AA seqDB search
MSYRYKIEITDVTLRDGMHAVRHQFSVEDAKAIASALDRTGVAKIEASHGDGLGGSSIQY
GFSKESEEDYVGAVCQTVKTSQVVALLLPGIGTLEDLKRAVGLGIRGVRVATHSTEADIS
AEHMEEARKMGLDVVGFLMMSHMTETERLVEEAKKMASYGAHCVYIVDSAGAMLMDEVRR
KVSALREALPDDVEVGFHAHNNLGVAVANSIAAVEEGAYRIDASLAGLGAGAGNTPLEVF
VAACEKYGIETGVDLYAAMDAAEDVVRPRMARPVLTDCTALTLGYAGVYSSFLLHAERAA
KQFGVDVRDILVELGRRRVVGGQEDMIVDVAYEIAHGKEANADGPVASVHRG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtatcggtacaagattgaaatcacggacgtcacgctccgcgacgggatgcacgcc
gtgaggcatcagttcagcgtcgaagatgccaaggccatcgcgagcgcgctggacaggacg
ggcgtggccaagatcgaggcgtcccacggcgatgggctcggcggaagctcgattcagtac
ggtttttcgaaggagtcggaagaggattacgtcggagcggtgtgtcagacggtgaagacc
tctcaggtcgtcgcgctactgttgcctggcatcggaacgctcgaagacttgaagcgcgcc
gtcggcctcggcatccgcggagtgcgggtcgccacacattccacggaggcggacatctcc
gcggaacacatggaggaagcgcgcaagatgggactcgatgtggtcggttttctcatgatg
agccacatgacggagaccgagcgcctggtggaagaggcgaagaagatggcctcttacggc
gcgcactgcgtgtacatcgtcgattcggcgggcgcgatgctcatggacgaggttcgccgc
aaggtgtccgcactgcgggaggctctgccggacgacgtcgaggtcggatttcacgcgcac
aacaacctcggcgtggcggtcgccaactccatcgcggccgtggaagagggcgcataccgg
attgacgcgagcctcgcggggctcggggcaggcgcgggaaacacgccgctcgaggtgttt
gtggccgcgtgcgagaaatacggcatcgagaccggcgtggacctgtacgccgccatggac
gccgcggaggacgtcgtgcgcccgcggatggcgcgacccgtcctgacggattgcacggcg
ctcacgctgggctacgcgggcgtgtattccagctttctcttgcacgccgagcgagcggcg
aagcagtttggggtcgacgtgcgcgacattcttgtggaactcggcaggcgccgcgtggtg
ggtggccaggaggatatgatcgtcgatgtcgcgtacgagatcgcgcacggcaaggaggcg
aacgcggatggccctgtcgcttccgtccatcgcggatga

DBGET integrated database retrieval system