KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2178Help
Entry
TC41_2178         CDS       T01821                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00071  Fatty acid degradation
aad00072  Synthesis and degradation of ketone bodies
aad00280  Valine, leucine and isoleucine degradation
aad00310  Lysine degradation
aad00362  Benzoate degradation
aad00380  Tryptophan metabolism
aad00620  Pyruvate metabolism
aad00630  Glyoxylate and dicarboxylate metabolism
aad00640  Propanoate metabolism
aad00650  Butanoate metabolism
aad00900  Terpenoid backbone biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
aad01212  Fatty acid metabolism
aad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TC41_2178 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    TC41_2178 (atoB)
   00640 Propanoate metabolism
    TC41_2178 (atoB)
   00650 Butanoate metabolism
    TC41_2178 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TC41_2178 (atoB)
   00072 Synthesis and degradation of ketone bodies
    TC41_2178 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TC41_2178 (atoB)
   00310 Lysine degradation
    TC41_2178 (atoB)
   00380 Tryptophan metabolism
    TC41_2178 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TC41_2178 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TC41_2178 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TC41_2178 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aad04147]
    TC41_2178 (atoB)
Enzymes [BR:aad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TC41_2178 (atoB)
Exosome [BR:aad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TC41_2178 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEJ44084
UniProt: F8IFB9
Position
complement(2071597..2072784)
Genome map
AA seq 395 aa AA seqDB search
MQDVVIAGAVRTPIGTFQGSLSLLSAPDLGAAVIRESLRRAGVESKAVDEVVMGNVLQAG
VGQNPARQAAMRAGIPEDIPATTVNMVCGSGLKSVMLAAQAIRAGDAGVLVAGGMESMSN
APYLLPGARDGYRMGHREVVDSMIRDGLWCAFCDIHMGVTAENVANRHGISREDQDRFAL
RSQMRAKEAMEEGRFKEEIVPVSVPRRKGDPALVDRDEHPRPDTTYEALAKLRPAFQADG
TVTAGNSSGINDGAAAMLVLGRDRAEELGVKPMARIVSYASVGLDPSVMGLGPIEATRRA
LNRAGLSVDDLDLIEANEAFAAQALAVARELSFPDDKLNVNGGAIALGHPIGASGARILV
TLLYELERRGGRFGLATLCIGGGQGVAMVVERLSR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagacgtagtgattgcaggggccgtgcggacgcccatcggaacgttccagggcagt
ctctcgctgctttcggcgccggatctcggcgcggccgtgatccgggaatcgctgcggcgc
gcaggggttgagtcgaaagcggtggacgaagtcgtgatgggcaacgtgctccaggcgggc
gtcggccagaatcccgcgcggcaagccgcgatgcgggcggggatccccgaagacatcccg
gcgacgacggtgaatatggtgtgcggatccggcctgaagtcggtcatgctcgcggcgcaa
gccatccgcgctggggacgcgggcgtcctggtggcgggcggcatggagtcgatgtcgaac
gcgccgtacctgcttccaggggcgcgcgacggctaccgcatgggccatcgcgaagtcgtc
gacagcatgatcagggacggcctctggtgcgcgttttgcgacatccacatgggcgtcacc
gccgaaaacgtggcgaaccgccacggcatcagccgggaggatcaggaccgtttcgccctc
aggagccagatgcgcgccaaggaagcgatggaggaaggccgcttcaaagaagaaatagtg
cccgtctccgtgccgcggcggaagggcgatccggccttggtcgaccgcgacgaacatccg
cgccccgacacgacgtatgaggcgttggcgaaactgcggcccgcgtttcaggcagacggc
accgtgaccgccggcaacagctcgggcatcaacgacggcgcggccgccatgctggtgctt
ggccgggatcgcgccgaggagcttggcgtgaagccgatggcgcgcattgtcagctacgcg
agcgtcggtcttgacccaagcgtaatgggcctcggtcccatcgaggcgacgcgccgggcg
ctcaaccgggccgggctttccgtggacgacctcgacctcatcgaggcgaacgaggcgttt
gcggcccaggcgctcgcggtggctcgcgagctgtcgttcccggatgacaagttgaacgtg
aacggcggcgccatcgcgctcggtcaccccatcggcgcgagcggagcgcgcatcttggtc
acgctcctgtacgagctcgagcgccgaggcggccgtttcggcctcgctacgctgtgcatc
ggcggaggacagggcgtcgccatggtcgtggaacgcctttcgcgttga

DBGET integrated database retrieval system