KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2238Help
Entry
TC41_2238         CDS       T01821                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AEJ44144
UniProt: F8IFR0
Position
complement(2133677..2134558)
Genome map
AA seq 293 aa AA seqDB search
MDVAWSAFRVAIAQFAPKLGDVSANLSRHLEYVNEAKQVNAQVLVFPELGLTGYQTQDLT
LEVARHVSHPDIQRLIQASQELDVIFSFVEEADDCRFFVTAAYASGGRLVHRHRKLYLPT
YGMFDERRYFAPGDRIRTFSAQGGQAGVLICEDAWHLSSPYLLAVQGASIIYVPASSPWR
NTMAASDFGSHAFWRQLLQVYAQLCGCFFVFANRVGYEDGVHFYGGSGVMGPDGEWVAEG
PASESALVVADLDFRMVRRARYTTPLLRDERVRLVLAEMQEAVRRRSTDEAGD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggcttggtcggcgttccgcgtcgccattgcgcagtttgcgcccaaactgggc
gacgtgtccgcgaatttgagccggcatctcgaatatgtgaacgaggccaaacaagtcaac
gcgcaggtgctcgtgtttcccgagctcgggctcaccgggtatcagacgcaggatctcacg
ctcgaggtggcgcgccatgtgagtcaccccgacattcaacgcctcattcaggcgagccag
gaactggatgtgatcttctctttcgtcgaggaggcggacgactgccgcttttttgtgacg
gcggcctacgcatccggcggccgcctcgtgcaccggcaccggaagctgtaccttccgacc
tacgggatgttcgacgaacgtcgctactttgcgccgggcgacagaatccgcaccttttcc
gcgcagggaggacaagctggcgtcttgatctgcgaggatgcctggcacctttcaagtcct
tatctgctcgcggtgcagggcgcgtccatcatctatgttccggcttctagcccatggcgc
aacaccatggccgcttccgatttcggttcgcatgctttctggcggcagttgctgcaggtg
tatgcgcagctgtgtggctgcttttttgtcttcgccaaccgcgtcggctacgaggacggc
gtccatttttacggaggcagcggcgtgatggggccggatggggagtgggtggccgaaggg
cccgcatccgagagcgcgttggtcgtggccgatctcgactttcgaatggtgcggcgggcg
cgctacacgacgcccctcttgcgcgacgagcgcgttcgcctcgtgctcgccgagatgcag
gaggctgtgcgcaggaggtcgaccgatgaggccggagattga

DBGET integrated database retrieval system