KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2240Help
Entry
TC41_2240         CDS       T01821                                 

Definition
(GenBank) aminoglycoside phosphotransferase
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase Kdo Pkinase Haspin_kinase RIO1 Homoserine_dh Pkinase_Tyr Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AEJ44145
UniProt: F8IFR1
Position
complement(2134647..2135588)
Genome map
AA seq 313 aa AA seqDB search
MDAGEMADLVRRAYGIEAEAIVHKRTVWGIVAGTSRYILKRARPQDSEERLRALADVLRH
YPRFGVAAASPLETARGTMRVSDGRGAWYYLQLWLEGRHVDASDESERLAVTRALARAQR
AAPTQGVLRALQTATLRDKWRAKLQLLERLKAVTADAEMAELLRRIAARARAVYASYVEG
ARPLAFCHRDLAPHNVLVGPGGTVMFIDFDHAGYDDPFADPIQWVSHVAYLVPLCSRSYQ
RLWLAYAQEAELHEEHLVSLVRLGAWPDMALRALAEAFRGGQSASRMWRLRYALRREEER
ARLHEAWLRELEA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggatgccggcgaaatggccgacctcgtccgccgcgcgtacggcatcgaagcggaggct
atcgtgcataagcgcacggtctgggggattgtcgcggggacgtcgcggtatatcttaaag
cgcgcacgtccccaggacagcgaggagcgccttcgggcgctcgccgacgtcctccgtcac
tatccgcgctttggcgttgccgccgccagtccgctcgagacggcgcgcgggacaatgcgc
gtctccgacgggcgcggcgcgtggtattatctccagctttggctcgaaggccggcatgtc
gacgcgagcgacgaatcggagcgccttgcggtcacgcgtgcgctggcgcgggcccagcgc
gctgcgccgacccaaggggtccttcgcgctttgcaaaccgccacgttgcgagacaaatgg
cgggcgaaactccagctcctcgaacggctcaaggccgtgacggccgatgccgagatggcc
gagttgctccgccgcatcgccgctcgcgctcgcgcggtgtacgcgtcttacgtggaggga
gcgcgtccgctcgccttctgtcaccgcgatctcgcgccccacaacgtgctcgtcggtcca
ggcgggactgtgatgttcatcgacttcgatcacgccggctacgatgatccgtttgccgat
cccattcagtgggtgagccacgtcgcatacctggttcctctgtgttcccgctcgtatcaa
cggctctggctcgcctacgcgcaggaggcggaactgcatgaggagcacctggtgtcgctc
gtgaggctcggtgcgtggccggacatggcgctgcgcgcgctcgcggaagcgtttcgcgga
ggtcaatccgcgagccggatgtggcggcttcgctatgcgctcaggcgcgaagaggagcgc
gctcgcctgcacgaagcctggttgcgcgagctcgaagcctga

DBGET integrated database retrieval system